DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30350 and PPIE

DIOPT Version :9

Sequence 1:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001181936.1 Gene:PPIE / 10450 HGNCID:9258 Length:314 Species:Homo sapiens


Alignment Length:363 Identity:69/363 - (19%)
Similarity:117/363 - (32%) Gaps:114/363 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AKPKKIL--GGLLMVNHMKMWH---------------------QHRERIKGAISTVDAEAPNFQA 80
            |..|::|  |||......|:.|                     :||     ..:.|:.|.....|
Human     2 ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHR-----GFAFVEFELAEDAA 61

  Fly    81 ARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMR-THGAINPFRYDTVHAVSSIPMALLTLEKL 144
            |.|..:|    |::.|.:..:.|      :::.|| ..|:..|...|                  
Human    62 AAIDNMN----ESELFGRTIRVN------LAKPMRIKEGSSRPVWSD------------------ 98

  Fly   145 ERDN--RDFGRRILEVNSEVDSGLSDKRMREGRSSTPVAPLELPPQAMAKYEAFNIPLPKSDAEL 207
              |:  :.|..:.||.|.|          .||..         ||:|..:.   ..|:.|     
Human    99 --DDWLKKFSGKTLEENKE----------EEGSE---------PPKAETQE---GEPIAK----- 134

  Fly   208 RRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVVLQLIKSCMCNQHSKFMVK-----RLFPNL 267
            :....|::|.|:.:.: :|.||..:.|.::..|:.....  .|:|.....|..|     |:.|..
Human   135 KARSNPQVYMDIKIGN-KPAGRIQMLLRSDVVPMTAENF--RCLCTHEKGFGFKGSSFHRIIPQF 196

  Fly   268 WLETDLMLSSDSLLHQPLE----YDAKVIDHGASSYVLS------FSKAYVTGFTHHLSFAISFK 322
            ..:     ..|...|....    |..|..|   .:::|.      .|.|.....|:...|.::..
Human   197 MCQ-----GGDFTNHNGTGGKSIYGKKFDD---ENFILKHTGPGLLSMANSGPNTNGSQFFLTCD 253

  Fly   323 PLTVVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSRG 360
            ....::|..|.||.:.:|..:...|:.........:||
Human   254 KTDWLDGKHVVFGEVTEGLDVLRQIEVAPDTKASKARG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 18/97 (19%)
cyclophilin 212..369 CDD:294131 32/164 (20%)
PPIENP_001181936.1 RRM <5..>84 CDD:223796 18/93 (19%)
RRM_PPIE 8..80 CDD:240793 16/80 (20%)
cyclophilin_ABH_like 140..279 CDD:238907 29/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.