DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30345 and CG18281

DIOPT Version :9

Sequence 1:NP_724760.2 Gene:CG30345 / 246553 FlyBaseID:FBgn0050345 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_649236.1 Gene:CG18281 / 40274 FlyBaseID:FBgn0037003 Length:542 Species:Drosophila melanogaster


Alignment Length:472 Identity:87/472 - (18%)
Similarity:164/472 - (34%) Gaps:141/472 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 TVPAIVSLFLGPWSDKFGRRPILLSTFT-------GYLFSAII----------LVVLTQITTA-- 163
            |||.|..|     |..||.|.:|:....       |::.:.::          :|:|..:.|.  
  Fly    43 TVPFIEKL-----SGSFGNRVLLVDGLVYGVRGILGFVTTPVMGAISDFHGRKVVMLLAVATTYA 102

  Fly   164 ----VNISPWWFLLSSVPSVFSGGTCALITILYCYVSDVATENKRAMRMVTMEAALGLGMMAGGV 224
                :.:..|||......|...|.|   .:....||:|..|...|:.....:.|:.|.|:.....
  Fly   103 PIPFMMLKSWWFFAILTVSSICGST---YSSSLAYVADTTTVENRSKGYGIVAASFGAGIAFSPS 164

  Fly   225 ASGYIYAATGASILFILVGSIISIALLYVYFFVAESL---------------KSEDL-------- 266
            ...|:..:.|::.:.::......|.::::.|.|.|||               |.||:        
  Fly   165 LGNYLMKSYGSASVILIAAITGLINIMFIIFAVPESLVLKEKNNMLDEESDNKMEDINPKERKEI 229

  Fly   267 ----------------------------ETGSRIREFFRL------------------DLVKVLV 285
                                        |.|.:..:...|                  ||.:||.
  Fly   230 LNREEKLNNHVSANKSNHGTSQNLVTNKELGQQFNKEENLQNDLTEKEKIDNGSLNSSDLWEVLR 294

  Fly   286 KTCIRKRENYDRAIIWFVMMSLTLCVFAMEGESTVNYMFMRKQFDYTVQDYSVFNA--------- 341
            |:  ||.:|   .::.:::..|::..||  |..:...::::....:..::.|:...         
  Fly   295 KS--RKDKN---LLVIYLITFLSIWPFA--GVDSTAPVYLKTNMGFEYEEVSMMLGLLSVLAITS 352

  Fly   342 ---ARVVIQVVGS--TIAMILLRRLL-----GLST-----IMMTLLAFACCVLESTVRATA-VYG 390
               ...:|.:||:  :|.:.||..||     |..|     .:.::||....::.:...|.| :|.
  Fly   353 NLLLGYIINIVGAKWSIRLGLLLLLLQLFFFGFGTHHWMYWLSSILAALATIIPAANNAVASIYA 417

  Fly   391 SEMYLALMVGMMRGV------MSPMCKAILSHVTPSSELGKIFSLTTSLQSISPLG---AAPLYT 446
            |......::|::.|:      :.|....:|..:.......|:.|..:....||.:|   |..|..
  Fly   418 SPDNRGAVLGIISGIECLSEGVGPAFFGVLFFIFQDDSKNKVNSPISMPFVISAIGVFVAIVLTG 482

  Fly   447 AVYQATVNFYPGIFNFI 463
            .:.:.||...|.|:..|
  Fly   483 FIKKETVEKAPLIYKII 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30345NP_724760.2 MFS_1 102..437 CDD:284993 77/441 (17%)
MFS 121..472 CDD:119392 84/469 (18%)
CG18281NP_649236.1 MFS 25..485 CDD:119392 82/456 (18%)
MFS_1 30..441 CDD:284993 73/412 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.