DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30345 and Mfsd14a

DIOPT Version :9

Sequence 1:NP_724760.2 Gene:CG30345 / 246553 FlyBaseID:FBgn0050345 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_032272.2 Gene:Mfsd14a / 15247 MGIID:1201609 Length:490 Species:Mus musculus


Alignment Length:360 Identity:80/360 - (22%)
Similarity:159/360 - (44%) Gaps:46/360 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IEGQVQEYASTITMISSMLESTVPAIVSLFLGPWSDKFGRRPILLSTFTGYLFSAIILVVLTQIT 161
            :.|.:|.....::.:|:.|           :|..||.:||:..||.|    :|.....:.|    
Mouse    73 MNGLIQGVKGLLSFLSAPL-----------IGALSDVWGRKSFLLLT----VFFTCAPIPL---- 118

  Fly   162 TAVNISPWW-FLLSSVPSVFSGGTCALITILYCYVSDVATENKRAMRMVTMEAALGLGMMAGGVA 225
              :.||||| |.:.||..||:    ...::::.||:|:..|::|:|....:.|.....::.....
Mouse   119 --MKISPWWYFAVISVSGVFA----VTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAI 177

  Fly   226 SGYIYAATGASILFILVGSIISIALLYVYFFVAESL--KSEDLETGSRIREFFRLDLVKVLVKTC 288
            ..|:....|.|::.:|..:|..:.:.::...|.|||  |......|:.| .:.:.|....|    
Mouse   178 GAYLGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASWGAPI-SWEQADPFASL---- 237

  Fly   289 IRKRENYDRAIIWFVMMSLTLCVFAMEGESTVNYMFMRKQFDYTVQDYSVFNAARVVIQVVGSTI 353
              |:...| :|:..:.:::.|......|:.:..::::|:...::.:..:.|.|...::.::..||
Mouse   238 --KKVGQD-SIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKFSPESVAAFIAVLGILSIIAQTI 299

  Fly   354 AMILLRRLLGLSTIMMTLLAFACCVLESTVRATAVYGSE---MYLALMVGMMRGVMSPMCKAILS 415
            .:.||.|.:|....::..|.|....|     |...:|||   |:.|..|..|..:..|...|::|
Mouse   300 VLSLLMRSIGNKNTILLGLGFQILQL-----AWYGFGSEPWMMWAAGAVAAMSSITFPAVSALVS 359

  Fly   416 HVTPSSELGKIFSLTTSLQSI-SPLGAAPLYTAVY 449
            ....:.:.|.:..:.|.::.: :.||.| ||..::
Mouse   360 RTADADQQGVVQGMITGIRGLCNGLGPA-LYGFIF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30345NP_724760.2 MFS_1 102..437 CDD:284993 74/341 (22%)
MFS 121..472 CDD:119392 76/336 (23%)
Mfsd14aNP_032272.2 MFS_MFSD14 37..449 CDD:340945 80/360 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.