DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30345 and mfsd14bl

DIOPT Version :9

Sequence 1:NP_724760.2 Gene:CG30345 / 246553 FlyBaseID:FBgn0050345 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001135533.1 Gene:mfsd14bl / 100216076 XenbaseID:XB-GENE-22168215 Length:475 Species:Xenopus tropicalis


Alignment Length:331 Identity:75/331 - (22%)
Similarity:147/331 - (44%) Gaps:37/331 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LGPWSDKFGRRPILLSTFTGYLFSAIILVVLTQITTAVNISPWW-FLLSSVPSVFSGGTCALITI 190
            :|..||.:||:..||.|    :|.....:.|      :.||||| |.:.||...||    ...::
 Frog    77 IGALSDVYGRKSFLLLT----VFFTCFPIPL------MRISPWWYFAMISVSGAFS----VTFSV 127

  Fly   191 LYCYVSDVATENKRAMRMVTMEAALGLGMMAGGVASGYIYAATGASILFILVGSIISIA-LLYVY 254
            ::.||:|:..|::|:.....:.|.....::.......||....|.: |.:||.:::::. :.::.
 Frog   128 IFAYVADITQEHERSTAYGLVSATFAASLVTSPAIGAYISEFYGDN-LVVLVATVVALLDICFIL 191

  Fly   255 FFVAESLKSEDLET--GSRIREFFRLDLVKVLVKTCIRKRENYDRAIIWFVMMSLTLCVFAMEGE 317
            ..|.|||:.:...|  |:.| .:.:.|....|      |:...|..:: .:.:::.|......|:
 Frog   192 LAVPESLREKMRPTTWGAPI-SWEQADPFASL------KKIGKDTTVL-LICITVFLSYLPEAGQ 248

  Fly   318 STVNYMFMRKQFDYTVQDYSVFNAARVVIQVVGSTIAMILLRRLLGLSTIMMTLLAFACCVLEST 382
            .:..::::|:...:.....:.|.|...::.:|..|:.:.:|.|.:|....::..|.|....|   
 Frog   249 YSSFFLYLRQIIGFNSGSIAAFIAVVGILSIVAQTVLLSILMRSIGNKNTVLLGLGFQMFQL--- 310

  Fly   383 VRATAVYGSE---MYLALMVGMMRGVMSPMCKAILSHVTPSSELGKIFSLTTSLQSI-SPLGAAP 443
              |...:||:   |:.|..|..|..:..|...|::|....|.:.|....:.|.::.: :.||.| 
 Frog   311 --AWYGFGSQPWMMWAAGAVAAMSSITFPAVSALISRNAESDQQGVAQGMVTGIRGLCNGLGPA- 372

  Fly   444 LYTAVY 449
            ||..|:
 Frog   373 LYGFVF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30345NP_724760.2 MFS_1 102..437 CDD:284993 69/317 (22%)
MFS 121..472 CDD:119392 75/331 (23%)
mfsd14blNP_001135533.1 MFS 25..378 CDD:119392 74/329 (22%)
MFS_1 27..371 CDD:284993 70/321 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D763423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.