DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30344 and SLC46A2

DIOPT Version :9

Sequence 1:NP_724759.1 Gene:CG30344 / 246552 FlyBaseID:FBgn0050344 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_149040.3 Gene:SLC46A2 / 57864 HGNCID:16055 Length:475 Species:Homo sapiens


Alignment Length:432 Identity:89/432 - (20%)
Similarity:186/432 - (43%) Gaps:77/432 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RGSDADKEVEVIVQTYSANIMMTTSLLESIIPAFASLFLGPWSDKFGRRPILLTTFTGYLTGALI 164
            ||:..|::...|     :|..:..:|:..:.|..::..||..||::.|:..:..:..|:|...|.
Human    63 RGALEDQQQRAI-----SNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLG 122

  Fly   165 LIV---------ITYITRSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMV 220
            |::         :.|...:.|             .:.||..|..:|:....|..:.|.::::|::
Human   123 LLLKVLLDWPVEVLYGAAALN-------------GLFGGFSAFWSGVMALGSLGSSEGRRSVRLI 174

  Fly   221 LNEASLCAGIMVGNVASGYIYA-----ATNALVLFSIAGSLMMFALMYVLLF--VPESL-NPGDI 277
            |.:..|......|::|||:::.     :...|:|.:.:.|...|||:|.||.  ||||: .|.  
Human   175 LIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTACSVSCASFALLYSLLVLKVPESVAKPS-- 237

  Fly   278 HTGSRVREFFRFDLVTDLIRTC--------------------FKRRPNFDRTIIWLTMIALTIAI 322
                  :|....|.|:..:.|.                    .|.:|:  :|.|.|..:.  ..|
Human   238 ------QELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPH--KTTIALLFVG--AII 292

  Fly   323 FDMEGESTVNY--MFV-QDKFNWTIKDFSLFNASRIVIQIVGSIVGMLVLRRVLK-MSIVTMAML 383
            :|:....||:.  :|| ::...|.........|:...| .:.|.:|:||..|..: .:::.:.|:
Human   293 YDLAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTI-FITSFLGVLVFSRCFRDTTMIMIGMV 356

  Fly   384 SLAC-CVLESTVRATAVYWQELYLGMTLGMMRGVMGPMCRAILSHVAPATEVGKIFALTTSMESV 447
            |... .:|.:.|:.|.::    |:...:.:...:.....|:.:|.:...:..||:|.:.....::
Human   357 SFGSGALLLAFVKETYMF----YIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLAL 417

  Fly   448 SPLGAAPLYTTVYKATLENYPGAFNFISAALYFVCYILIAVI 489
            :.:..:.||..:|:.|::.:.|:...:|:.|.|:..|.|:::
Human   418 TGVVTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPISIV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30344NP_724759.1 MFS 113..490 CDD:119392 85/419 (20%)
MFS_1 128..448 CDD:284993 73/361 (20%)
SLC46A2NP_149040.3 MFS_1 84..421 CDD:284993 73/366 (20%)
MFS <282..453 CDD:304372 35/177 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23507
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.