DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30344 and mfsd14ba

DIOPT Version :9

Sequence 1:NP_724759.1 Gene:CG30344 / 246552 FlyBaseID:FBgn0050344 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_002663499.2 Gene:mfsd14ba / 557306 ZFINID:ZDB-GENE-200414-1 Length:500 Species:Danio rerio


Alignment Length:473 Identity:95/473 - (20%)
Similarity:190/473 - (40%) Gaps:111/473 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQTYSANIMMT 122
            :||.|||..|:                       ..|:|            .|:.:|:..:..:.
Zfish    56 IFLEFFAWGLL-----------------------TTPML------------TVLHETFPTHTFLI 85

  Fly   123 TSLLESI--IPAFASL-FLGPWSDKFGRRPILLTTFTGYLTGALILIVITYITRSTNISPWWF-- 182
            ..|::.:  :.:|.|. .:|..||.:|||..||.|.  :.|.|.|.::        .:||||:  
Zfish    86 NGLIQGVKGLLSFMSAPLIGALSDVWGRRSFLLVTV--FFTCAPIPLM--------RLSPWWYFA 140

  Fly   183 LLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCAGIMVGNVASGYIYAATNAL 247
            ::|     |||......:.|:.||:||..||:::....|..|:..|.::.......|:.|:....
Zfish   141 MIS-----VSGAFSVTFSVIFAYIADVTDERERSTAYGLVSATFAASLVTSPAIGAYLSASYGDN 200

  Fly   248 VLFSIAGSLMMFALMYVLLFVPESL-NPGDIHTGSRVREFFRFDLVTDLIRTCFKRRPNFDRTII 311
            ::..:|..:.:..:.::||.||||| :...::|......:.:.|....|      |:...|.|::
Zfish   201 LVVLVATLIALADICFILLAVPESLPDKMRLNTWGAPISWEQADPFASL------RKVGQDTTVL 259

  Fly   312 WLTMIALTIAIFDMEGESTVNYMFVQDKFNWTIKDFSLFNASRIVIQIVGSIVGMLVLRRVL--K 374
             |..|.:.::.....|:.:..:::::...|::.|..::|.....::.|:...:.:.:|.|.:  |
Zfish   260 -LICITVFLSYLPEAGQYSSFFLYLRQVINFSPKTIAVFIGVVGILSILAQTLFLTLLMRTIGNK 323

  Fly   375 MSIV---------------------------TMAMLSLACCVLESTVRATAVYWQELYLGMTLGM 412
            .:::                           ..||.|:....:.:.|..:|...::   |:..||
Zfish   324 NTVLLGLGFQILQLAWYGLGSEPWMMWAAGAVAAMSSITFPAVSALVSRSADPDKQ---GLVQGM 385

  Fly   413 MRGVMGPMCRAILSHVAPATEVGKIFALTTSMESVSPLG---AAPLYTTVYKATLENYPGAFNFI 474
            :.|:.| :|..:    .||......|.....:..::|:.   |.|:.|...|.|:...|    |:
Zfish   386 ITGIRG-LCNGL----GPALYGFVFFLFNVELSGITPIQPDFAIPIQTPTEKTTIPGPP----FL 441

  Fly   475 SAALYFVCYILIAVIFGI 492
            ..|    |.:::|.|..:
Zfish   442 LGA----CTVVVAFIVAL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30344NP_724759.1 MFS 113..490 CDD:119392 85/414 (21%)
MFS_1 128..448 CDD:284993 72/354 (20%)
mfsd14baXP_002663499.2 MFS 52..409 CDD:119392 83/417 (20%)
MFS_1 54..398 CDD:284993 80/406 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D763423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.