DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30344 and mfsd14a1

DIOPT Version :9

Sequence 1:NP_724759.1 Gene:CG30344 / 246552 FlyBaseID:FBgn0050344 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_998692.2 Gene:mfsd14a1 / 406848 ZFINID:ZDB-GENE-040426-2935 Length:485 Species:Danio rerio


Alignment Length:448 Identity:94/448 - (20%)
Similarity:177/448 - (39%) Gaps:117/448 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQTYSANIMMT 122
            :||.|||..|:.|                       |.||            .:.:|:..:..:.
Zfish    42 IFLEFFAWGLLTA-----------------------PTLG------------ALDETFPKHTFLM 71

  Fly   123 TSLLESI--IPAFASL-FLGPWSDKFGRRPILLTTFTGYLTGALILIVITYITRSTNISPWWF-- 182
            ..|::.:  :.:|.|. .:|..||.:||:..||.|.  :.|.|.|.::        .|||||:  
Zfish    72 NGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLLLTV--FFTCAPIPLM--------KISPWWYFA 126

  Fly   183 LLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCAGIMVGNVASGY---IYAAT 244
            ::|     |||......:.|:.|::|:.:|.::::...:..|:..|.:::......|   :|..|
Zfish   127 MIS-----VSGVFAVTFSVIFAYVADITQEHERSMAYGMVSATFAASLVISPAIGAYLSHVYGDT 186

  Fly   245 NALVLFSIAGSLMMFALMYVLLFVPESLNPGDIHTGS--RVREFFRFDLVTDLIRTCFKRRPNFD 307
            ..:||   |.::.|..:.::|:.||||| |..:...|  ....:.:.|....|      |:...|
Zfish   187 LVVVL---ASAIAMLDICFILVAVPESL-PEKMRPASWGAPISWEQADPFASL------RKVGQD 241

  Fly   308 RTIIWLTMIALTIAIFDMEGESTVNYMFVQDKFNWTIKDFSLFNASRIVIQIVG--SIVGMLVLR 370
            .|:: |..|.:.::.....|:::..::::|....::.:..:.|      |.::|  |:|...|:.
Zfish   242 STVL-LICITVFLSYLPEAGQNSSFFLYLQQIMGFSSESVAAF------IAVLGLLSVVAQTVVL 299

  Fly   371 RVLKMSI--VTMAMLSLACCVLESTVRATAVY------WQELYLGMTLGMMRGVMGPMCRAILSH 427
            .:|..||  ....:|.|...:|:     .|.|      |. ::....:..|..:..|...|::|.
Zfish   300 SLLMRSIGNKNTILLGLGFQILQ-----LAWYGFGSEPWM-MWAAGAVAAMSSITFPAVSALISR 358

  Fly   428 VAPATEVGKIFALTTSMESVSPLGAAPLYTTVYKATLENYPGAFNFISAALY-FVCYI 484
            .|...:.|....:.|.:.                       |..|.:..||| |:.||
Zfish   359 TADPDQQGVGQGMVTGIR-----------------------GLCNGLGPALYGFIFYI 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30344NP_724759.1 MFS 113..490 CDD:119392 84/393 (21%)
MFS_1 128..448 CDD:284993 74/339 (22%)
mfsd14a1NP_998692.2 MFS 38..395 CDD:119392 94/448 (21%)
MFS_1 40..384 CDD:284993 88/437 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.