DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30344 and CG5078

DIOPT Version :9

Sequence 1:NP_724759.1 Gene:CG30344 / 246552 FlyBaseID:FBgn0050344 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_649238.3 Gene:CG5078 / 40276 FlyBaseID:FBgn0037005 Length:447 Species:Drosophila melanogaster


Alignment Length:370 Identity:82/370 - (22%)
Similarity:156/370 - (42%) Gaps:57/370 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VEVIVQTYSANIMMTTSL---LESIIPAFASLFLGPWSDKFGRRPILLTT--FTGYLTGALILIV 167
            :..:.:|:..:..:...|   ::.|:...:|..:|..||.:||:.:||.|  ||.        :.
  Fly    46 IATLKETFPDHTFLMNGLVMGVKGILSFLSSPLIGALSDIYGRKVLLLITVIFTS--------LP 102

  Fly   168 ITYITRSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCAGIMV 232
            |..:|    :..|||.   |.|.:||......:..:.|::||..:.:::....|..|:..|.:::
  Fly   103 IPMMT----MDNWWFF---VISSISGVLGVSFSVAFAYVADVTTKEERSRSYELVSATFAASLVI 160

  Fly   233 GNVASGYIY--AATNALVLFSIAGSLMMFALMYVLLFVPESLNPGDIHTGSRVREFFRFDLVTDL 295
            .......|.  ...|.:||  :|..:....:|:|||.|||:|......||...::...|      
  Fly   161 APAMGNLIMDRYGINTVVL--VATLVSTTNVMFVLLAVPETLQQNVRSTGLSWKQADPF------ 217

  Fly   296 IRTCFKRRPNFDRTIIWLTMIALTIAIFDM-EGESTVNYMFVQDKFNWTIKDFSLFNASRIVIQI 359
               ...||...|..::.|.::..|..:.:. |..|...|:.:...|::|  :.|...|...::.|
  Fly   218 ---LSLRRVGSDPNVLLLCVVMFTFLLPEAGEYSSVPAYLKLTMGFDFT--ELSTLVAFMAILGI 277

  Fly   360 -----VGSIVGMLVLRRVLKMSIVTMAMLSLACCVLESTVRATAVYWQELYLGMTLGMMRGVMGP 419
                 :||||..|..:..:        :|.|...:|:..:.|......:::|...:..:..:..|
  Fly   278 SINVTLGSIVKTLGAKNAI--------ILGLLLELLQLILFAIGYEKWQMWLAGNVAALSSITFP 334

  Fly   420 MCRAILSHVAPATEV---GKIFALTTSMESV-SPLGAAPLYTTVY 460
               |:.::|:..|:|   |.:..:.|.|..: |.||.| |:..|:
  Fly   335 ---AVSAYVSLYTDVETQGAVQGMITGMSGLCSGLGPA-LFGIVF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30344NP_724759.1 MFS 113..490 CDD:119392 82/365 (22%)
MFS_1 128..448 CDD:284993 74/333 (22%)
CG5078NP_649238.3 MFS 27..375 CDD:119392 81/368 (22%)
MFS_1 27..368 CDD:284993 78/360 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.