DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30344 and Mfsd14a

DIOPT Version :9

Sequence 1:NP_724759.1 Gene:CG30344 / 246552 FlyBaseID:FBgn0050344 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001316129.1 Gene:Mfsd14a / 103689987 RGDID:9294064 Length:490 Species:Rattus norvegicus


Alignment Length:458 Identity:86/458 - (18%)
Similarity:171/458 - (37%) Gaps:137/458 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLLGIDRGSDADKEVEVIVQTYSANIMMT 122
            :||.|||..|:.|                       |.|            .|:.:|:..:..:.
  Rat    44 IFLEFFAWGLLTA-----------------------PTL------------VVLHETFPKHTFLM 73

  Fly   123 TSLLESI--IPAFASL-FLGPWSDKFGRRPILLTTFTGYLTGALILIVITYITRSTNISPWWFLL 184
            ..|::.:  :.:|.|. .:|..||.:||:..||.|.  :.|.|.|.::        .|||||:. 
  Rat    74 NGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLLLTV--FFTCAPIPLM--------KISPWWYF- 127

  Fly   185 SSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCAGIMVGNVASGYIYAATNALVL 249
             :|.| |||......:.::.|::|:.:|.::::...|..|:..|.::.......|:.......::
  Rat   128 -AVIS-VSGVFAVTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYGDSLV 190

  Fly   250 FSIAGSLMMFALMYVLLFVPESLNPGDIHTGSRVREFFRFDLVTDLIRTCFKRRP-NFDRTIIW- 312
            ..:|.::.:..:.::|:.|||||..                          |.|| ::...|.| 
  Rat   191 VVLATAIALLDICFILVAVPESLPE--------------------------KMRPASWGAPISWE 229

  Fly   313 ------------------LTMIALTIAIFDMEGESTVNYMFVQDKFNWTIKDFSLFNASRIVIQI 359
                              |..|.:.::.....|:.:..:::::....::.:..:.|.|...::.|
  Rat   230 QADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKFSPESVAAFIAVLGILSI 294

  Fly   360 VG-SIVGMLVLRRVLKMSIVTMAMLSLACCVLESTVRATAVY------WQELYLGMTLGMMRGVM 417
            :. :||..|::|.:...:.:   :|.|...:|:     .|.|      |. ::....:..|..:.
  Rat   295 IAQTIVLSLLMRSIGNKNTI---LLGLGFQILQ-----LAWYGFGSEPWM-MWAAGAVAAMSSIT 350

  Fly   418 GPMCRAILSHVAPATEVGKIFALTTSMESVSPLGAAPLYTTVYKATLENYPGAFNFISAALY-FV 481
            .|...|::|..|.|.:.|.:..:.|.:.                       |..|.:..||| |:
  Rat   351 FPAVSALVSRTADADQQGVVQGMITGIR-----------------------GLCNGLGPALYGFI 392

  Fly   482 CYI 484
            .||
  Rat   393 FYI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30344NP_724759.1 MFS 113..490 CDD:119392 76/403 (19%)
MFS_1 128..448 CDD:284993 66/349 (19%)
Mfsd14aNP_001316129.1 MFS 40..397 CDD:119392 86/458 (19%)
MFS_1 42..386 CDD:284993 80/447 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.