DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and npy2rl

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001314731.1 Gene:npy2rl / 795311 ZFINID:ZDB-GENE-111115-4 Length:373 Species:Danio rerio


Alignment Length:308 Identity:88/308 - (28%)
Similarity:139/308 - (45%) Gaps:50/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQL 99
            |..:..:|..|:.||..::||:...::||:.||..|||:||||||...:|....:.....:.::.
Zfish    48 ILAYSTIILLGVVGNSLVIYVVYKFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLREWKF 112

  Fly   100 GCVGC----KLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILL 160
            |.|.|    ..:|..|.|..||    |:|::.||...||..::||::.....:|:..|||...:|
Zfish   113 GQVLCFTLPYAQGLAVHVSTIT----LNVIALDRHRCIVYHLDTRMSKDTCFLVIAITWVVSAVL 173

  Fly   161 ASPLAFYRSYRVRVWKNFTERYCKENTSVLPKYW---------YVLITILVW--LPLGIMLICYI 214
            |||||.:|.|.:      .:.....:..|..:.|         |.:.|:|:.  |||.|:...||
Zfish   174 ASPLAIFREYGI------VDLSPDNSIEVCGEKWPDSSTDSTLYSISTLLLQYVLPLAIISFAYI 232

  Fly   215 AIFYKL----------DRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREK 269
            .|:.||          ||:.:|             |...|.|..:|||||...|||....:..: 
Zfish   233 RIWSKLRNHVSPVGRNDRHHRR-------------RKTTKMLVTMVVVFAVSWLPFHAFQLAID- 283

  Fly   270 YFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAYYQI 317
             ....|......:|.:.:...:...:...|||:||:.|.|:|.|:..:
Zfish   284 -IDHSVLDMKDFRLLYTVFHIVAMCSTFANPLLYGWMNRNYRSAFVAV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 86/295 (29%)
7tm_1 48..303 CDD:278431 79/279 (28%)
npy2rlNP_001314731.1 7tm_4 55..331 CDD:304433 87/301 (29%)
7tm_1 61..316 CDD:278431 79/279 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.