DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and Npffr2

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_076470.1 Gene:Npffr2 / 78964 RGDID:620168 Length:417 Species:Rattus norvegicus


Alignment Length:353 Identity:90/353 - (25%)
Similarity:157/353 - (44%) Gaps:61/353 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DDFDFGKWDFPAERIW---------------------LHKPNGEITWKICTFLPLIAFGLYGNFS 51
            |....|.||    .||                     ||:|:....: |.::..:....:.||..
  Rat     6 DSNSSGSWD----HIWSGNDTQHPWYSDINITYMNYYLHQPHVTAVF-ISSYFLIFFLCMVGNTV 65

  Fly    52 MVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCKLEGFLVVVFLI 116
            :.:|:..||.:.:.||..|.|:|::|||....|..:.::::....:..|...||:.|.:..:.:.
  Rat    66 VCFVVIRNRYMHTVTNFFIFNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGISVA 130

  Fly   117 TAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAFY------RSYRVRVW 175
            .:|..|..::.||...:|.|.:.:||::...:::|..|...|.:.:|.|..      :.||||:.
  Rat   131 ASVFTLVAIAVDRFRCVVYPFKPKLTVKTAFVMIVIIWGLAITIMTPSAIMLHVQEEKYYRVRLS 195

  Fly   176 ---KNFTERYCKE---NTSVLPKYWYVLITILVWLPLGIMLICYIAIFYKL----------DRYE 224
               |..|..:|:|   |..:...|..||...:...||.:::|.|..|...|          .|.|
  Rat   196 SHNKTSTVYWCREDWPNQEMRRIYTTVLFATIYLAPLSLIVIMYARIGASLFKTSAHSTGKQRLE 260

  Fly   225 KRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYI-- 287
            :..:|::       |:.|.|.|..|.::|....||...|::|.:.   .|:|.:....:..|:  
  Rat   261 QWHVSKK-------KQKVIKMLLTVALLFILSWLPLWTLMMLSDY---ADLSPNKLRVINIYVYP 315

  Fly   288 -SQYLMFLNAAVNPLIYGFNNENFRRAY 314
             :.:|.|.|::|||:||||.|||||..:
  Rat   316 FAHWLAFCNSSVNPIIYGFFNENFRSGF 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 80/296 (27%)
7tm_1 48..303 CDD:278431 71/279 (25%)
Npffr2NP_076470.1 7tm_4 53..>176 CDD:304433 29/122 (24%)
7tm_1 62..332 CDD:278431 71/279 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.