DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and Npy2r

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_076458.1 Gene:Npy2r / 66024 RGDID:620475 Length:381 Species:Rattus norvegicus


Alignment Length:310 Identity:93/310 - (30%)
Similarity:146/310 - (47%) Gaps:57/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQL 99
            |..:..:|..|:.||..:::|:...:|:|:.||..|||:||||||...:|....:.......:::
  Rat    54 ILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKM 118

  Fly   100 GCVGCKL----EGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILL 160
            |.|.|.|    :|..|.|..||    |:|::.||...||..:|::::.:...:::...|....||
  Rat   119 GPVLCHLVPYAQGLAVQVSTIT----LTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALL 179

  Fly   161 ASPLAFYRSYR-VRVWKNF-----TERYCKENTSVLPKYWYVLITILVW--LPLGIMLICYIAIF 217
            |||||.:|.|. :.:..:|     ||::..|..||.... |.|.|:|:.  |||||:...|..|:
  Rat   180 ASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTV-YSLSTLLILYVLPLGIISFSYTRIW 243

  Fly   218 YKL----------DRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLP---FTILV----- 264
            .||          |.|.:|            :....|.|..||||||...||   |.:.|     
  Rat   244 SKLKNHVSPGAASDHYHQR------------RHKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSH 296

  Fly   265 VLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAY 314
            ||..|.:          :|.:.:...:...:...|||:||:.|.|:|:|:
  Rat   297 VLDLKEY----------KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 91/301 (30%)
7tm_1 48..303 CDD:278431 84/284 (30%)
Npy2rNP_076458.1 7tm_4 61..340 CDD:304433 92/303 (30%)
7tm_1 67..325 CDD:278431 84/284 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.