DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and prlhr2a

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001034615.1 Gene:prlhr2a / 654782 ZFINID:ZDB-GENE-060209-1 Length:370 Species:Danio rerio


Alignment Length:306 Identity:70/306 - (22%)
Similarity:130/306 - (42%) Gaps:51/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TFLPLI--------AFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDF 93
            :|.|||        ..|::||:.::|||...:.:.:.||..|.|:|.:|:|..|.|....:...|
Zfish    56 SFKPLIIPCYALVVLVGVFGNYLLLYVICQTKKMHNVTNFFIGNLAFSDMLMCATCVPFTLAYAF 120

  Fly    94 Y-QNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSG 157
            . :.:..|...|.|...:..|.:..:|..|:.:..||..|.|.|::.|:::.....::...|:..
Zfish   121 NPRGWVFGRFMCYLVFLIQPVTVYVSVFTLTAIGVDRYYATVHPLKKRISVLACTYLLSGIWILS 185

  Fly   158 ILLASPLAFYRSYRVRVWKNFTERYCKENTSVLPKYW-----------YVLITILVWLPLGIMLI 211
            ..|.:| |...:|.|        .:..|..::..::|           |..:.|...|||..:.|
Zfish   186 CGLVAP-AVAHTYHV--------EFKDEGFTICEEFWMGQEKERLAYAYSTLFITYVLPLSALCI 241

  Fly   212 CYIAIFYKL-------DRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREK 269
            .|:.|..||       .|.:.:..::.     :.||...:.:.:||..|....||.::..|||  
Zfish   242 SYLCISVKLRNCVVPGHRTQSQAEAQR-----ARKRKTFRLVSLVVAAFGICWLPISVFNVLR-- 299

  Fly   270 YFGEDVSVSSGMQLFWYISQYLMFL----NAAVNPLIYGFNNENFR 311
                |:.:....:.::.:.|.|..|    ::..||.:|.:.::.||
Zfish   300 ----DIDIDLIDKRYFLLIQLLCHLCGMSSSCCNPFLYAWLHDRFR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 66/291 (23%)
7tm_1 48..303 CDD:278431 62/277 (22%)
prlhr2aNP_001034615.1 7tm_4 67..>276 CDD:304433 49/222 (22%)
7tm_1 75..333 CDD:278431 62/277 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.