DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and npffr1l3

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001082858.1 Gene:npffr1l3 / 561324 ZFINID:ZDB-GENE-070424-44 Length:412 Species:Danio rerio


Alignment Length:306 Identity:79/306 - (25%)
Similarity:135/306 - (44%) Gaps:42/306 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCV 102
            :|.:....|.||..:..::..||.:|:.||:.|.|:||:|||....|....:|::....:.....
Zfish    24 YLFIFLLCLMGNALVCVIVLRNRHMRTVTNIFILNLAVSDLLVGIFCIPTTLVDNLITGWPFSNT 88

  Fly   103 GCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASP---- 163
            .|||.|.:..:.:..:|..|..::.||...||.|.:.:||:...::.:...|:..:.:..|    
Zfish    89 VCKLSGLVQGMSVSASVFTLVAIAVDRFRCIVYPFKPKLTLFIAKVSIGTIWLLALTIMFPSVLM 153

  Fly   164 --------------------LAFYRSYRVRVWKNFTERYCKENTSVLPKYWYVLITILVWLPLGI 208
                                ...|..|  ..|.:...|  |..|:||..:.||       :||.:
Zfish   154 LTVEQERAHFMIYNDDQNNTYPLYSCY--ETWPDPEMR--KIYTTVLFLHIYV-------IPLAL 207

  Fly   209 MLICYIAIFYKLDRYEKRVLSRENPLTVSYKRS--VAKTLFIVVVVFAALRLPFTILVVLREKYF 271
            :::.|..|..||  |...|....|   ...||.  |.|.|.:|.::|....||...|::|.:...
Zfish   208 IMLMYGRIGAKL--YSAAVSEHAN---AQGKRKIRVVKMLIMVALLFMLSWLPLWTLMMLTDYGH 267

  Fly   272 GEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAYYQI 317
            .::.|:.......:.:|.:|.|.|::|||:|||:.||||:|.:..:
Zfish   268 PDNDSLEILTSYIFPLSHWLAFSNSSVNPIIYGYFNENFKRGFQAV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 78/296 (26%)
7tm_1 48..303 CDD:278431 69/280 (25%)
npffr1l3NP_001082858.1 7tm_4 28..>148 CDD:304433 31/119 (26%)
7tm_1 34..299 CDD:278431 69/280 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.