DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and npffr1l1

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001165167.1 Gene:npffr1l1 / 559950 ZFINID:ZDB-GENE-091118-18 Length:398 Species:Danio rerio


Alignment Length:386 Identity:93/386 - (24%)
Similarity:162/386 - (41%) Gaps:66/386 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LHKPNGEITWKICTFLP------------------LIAFGLYGNFSMVYVIATNRSLRSPTNLII 70
            |:.....::|:.||.||                  ::...:.||..:..|:..||::||.|||.|
Zfish     6 LNHSAANLSWQNCTLLPYYIHSAGMAVSYILSYLLVLLLCVVGNGLVCLVVIRNRNMRSVTNLFI 70

  Fly    71 ANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVL 135
            .|:||:|||....|....:::.....:....:.|.:...:..:.:..:|..|..::.||.|.||.
Zfish    71 LNLAVSDLLVGIFCVPTTLIDSLISGWPFSQITCTMSNLVQGMSVSASVFTLVAIAVDRFTGIVY 135

  Fly   136 PMETRLTIRGVQIVVVCTWVSGILLASPLAFYRSYRVRVWKNFTERYCKENTSVLP--------- 191
            |...||........:|..|    |||..:.|..:..:.| .:..:.|..:|..:.|         
Zfish   136 PFHHRLRPVTALFAIVFIW----LLAFAIIFPSAATLTV-IHLDDMYMVQNDQIYPLFVCFEDWP 195

  Fly   192 -----KYWYVLITILVWL-PLGIMLICYIAIFYKL--DRYEKRVLSRENPLTVSYKRSVAKTLFI 248
                 :.:..:|.:.|:| |||::.|.|..|..||  :..|.|:.||.       :..|.|.|.:
Zfish   196 RADMRRVYTTVIFVHVYLAPLGLISIMYGCIAAKLSSNLQENRLRSRR-------RMKVIKMLIM 253

  Fly   249 VVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRA 313
            |.|:|....||...|::|.:....:...:.......:.::.:|.|.|:.|||:||||.||||||.
Zfish   254 VAVLFMVSWLPLWTLMLLTDYQDLDRQQIDFLSSYLFPVAHWLAFFNSGVNPIIYGFFNENFRRG 318

  Fly   314 YYQISWVRRWRDATQMKKFSRSPDHCCYCAFMKNGKRTSEAAQKAGNLEKDISKDMSSAQQ 374
            :                   ::...|.:|:.:.:..|.:.......|...|.|:.::|.::
Zfish   319 F-------------------QAAVACGFCSSVASEMRHTHFVLPPPNKVSDGSRGVTSGRK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 80/287 (28%)
7tm_1 48..303 CDD:278431 70/271 (26%)
npffr1l1NP_001165167.1 7tm_4 48..319 CDD:304433 80/282 (28%)
7tm_1 48..308 CDD:278431 70/271 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.