DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and NPY4R

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001265723.1 Gene:NPY4R / 5540 HGNCID:9329 Length:375 Species:Homo sapiens


Alignment Length:280 Identity:74/280 - (26%)
Similarity:129/280 - (46%) Gaps:15/280 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCKLEGF 109
            |:.||..::.|....:...:.|||:|||:|.:|.|...:|..:..|......:..|...||:..|
Human    55 GVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAF 119

  Fly   110 LVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPL--------AF 166
            :..:.:..::|:|.:|:.:|...|:.|...:.:|....:.:|..||...:|:.|.        .|
Human   120 IQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSILENVF 184

  Fly   167 YRSYRVRVWKNFTERYCKENTSVLPK---YWYVLITILVWLPLGIMLICYIAIFYKLDRYEKRVL 228
            ::::...:.....:..|.|:..:...   |...|:.....||||.:|:||..|:..|.| :.||.
Human   185 HKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRCLQR-QGRVF 248

  Fly   229 SREN-PLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLM 292
            .:.. .|...:.:.|...|.::||.||.|.||..:...| |.:..|.:.:..| .|.:.:...|.
Human   249 HKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSL-EDWHHEAIPICHG-NLIFLVCHLLA 311

  Fly   293 FLNAAVNPLIYGFNNENFRR 312
            ..:..|||.||||.|.||::
Human   312 MASTCVNPFIYGFLNTNFKK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 74/280 (26%)
7tm_1 48..303 CDD:278431 66/266 (25%)
NPY4RNP_001265723.1 7tm_1 58..322 CDD:278431 66/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.