DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and NPY1R

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_000900.1 Gene:NPY1R / 4886 HGNCID:7956 Length:384 Species:Homo sapiens


Alignment Length:298 Identity:72/298 - (24%)
Similarity:135/298 - (45%) Gaps:12/298 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFM 89
            |.|...|......:..:|..|:.||.:::.:|...:.:|:.||::|.|::.:|||...:|.....
Human    34 HLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTF 98

  Fly    90 VNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTW 154
            |.....::..|...|||..|:..|.:..::.:|.:::.:|...|:.|...|...|...:.:...|
Human    99 VYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIW 163

  Fly   155 VSGILLASPLAFYRSYRVRVWKNFT-----ERY-CKE---NTSVLPKYWYVLITILVWLPLGIML 210
            |..:..:.|...|:......::|.|     ::| |.:   :.|....|..:|:.:..:.||..:.
Human   164 VLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIF 228

  Fly   211 ICYIAIFYKLDRYEKRV-LSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGED 274
            |||..|:.:|.|....: ..|:|....|..:.:...|..:||.||...||.||...:.:  :...
Human   229 ICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFD--WNHQ 291

  Fly   275 VSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRR 312
            :..:....|.:.:......::..|||:.|||.|:||:|
Human   292 IIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 68/279 (24%)
7tm_1 48..303 CDD:278431 60/264 (23%)
NPY1RNP_000900.1 7tm_4 52..>176 CDD:304433 29/123 (24%)
7tm_1 57..320 CDD:278431 60/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.