DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and npy7r

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001007219.1 Gene:npy7r / 449010 ZFINID:ZDB-GENE-040924-9 Length:372 Species:Danio rerio


Alignment Length:301 Identity:84/301 - (27%)
Similarity:144/301 - (47%) Gaps:41/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQL 99
            |..:..:|..||.||..::|:|...|::|:.||..|||:|:|||:...:|....:|......::.
Zfish    51 ILAYSLIILLGLVGNTLVIYMIILYRNMRTVTNYFIANLALADLMVDTVCLPFTLVYTLLDEWKF 115

  Fly   100 GCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPL 164
            |.|.|.:..:...:.:..::|.|::::.:|...||..:..||......|::..||....:||.||
Zfish   116 GAVMCHMVPYSQALSVHVSILTLTIIALERYRCIVFHLGQRLNRCTSFIIIGLTWAFAAILAGPL 180

  Fly   165 AFYRSYR--------VRV------WKNFTERYCKENTSVLPKYWYVLITILVWLPLGIMLICYIA 215
            |.:|.||        :|:      |.|.|.|     .:|:.....:|:..:|  ||.|:...|:.
Zfish   181 AIFREYRYEEIPYIDLRIAVCSEKWPNGTNR-----DAVIYSLSMLLLQYVV--PLAIISYAYVC 238

  Fly   216 IFYKLDRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTIL-------VVLREKYFGE 273
            |:.||..:...  |..|...|..|:: .|.|.:||||||...|||.:.       ::|:.|.:  
Zfish   239 IWIKLKNHVSP--SNRNDGIVRRKKT-TKMLALVVVVFAVCWLPFHMFQLASDLDLILKFKEY-- 298

  Fly   274 DVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAY 314
                    :|.:.:...:...:..||||:||:.|:|:|..:
Zfish   299 --------KLIYTLFHIVAMCSTFVNPLLYGWMNQNYRNGF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 82/292 (28%)
7tm_1 48..303 CDD:278431 75/275 (27%)
npy7rNP_001007219.1 7tm_GPCRs 48..331 CDD:333717 84/299 (28%)
TM helix 1 50..74 CDD:320095 8/22 (36%)
TM helix 2 83..105 CDD:320095 9/21 (43%)
TM helix 3 121..143 CDD:320095 2/21 (10%)
TM helix 4 164..180 CDD:320095 5/15 (33%)
TM helix 5 214..237 CDD:320095 6/24 (25%)
TM helix 6 260..285 CDD:320095 12/25 (48%)
TM helix 7 299..324 CDD:320095 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.