DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and NPFR

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster


Alignment Length:383 Identity:86/383 - (22%)
Similarity:152/383 - (39%) Gaps:74/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WLHKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVAD-LLTLAICPA 86
            |.|       ..|..:..||.||..||..:|..:.....:|:..||.|.|:|::| ||.|...|.
  Fly    85 WYH-------MLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPL 142

  Fly    87 MFM-VNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVV 150
            ..| :...|..|....:.||....|..:.:..:.::::.:::||...||.|....|...|...::
  Fly   143 TLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTIL 207

  Fly   151 VCTWVSGILLASPLAFYR--------SYRVRVWKNFTERYCKEN-TSVLPKYWYVLITILV--WL 204
            ...|...:||||||..|:        :...::....|..||.|: .|...:::|.:.::.|  .:
  Fly   208 AGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLV 272

  Fly   205 PLGIMLICYIAIFYKLD---------------RYEK-RVLSRENPLTVSYKRSVAKTLFIVVVVF 253
            |:.|:.:.|..|:.||.               :.|: |.:.|.|.|.:|           :.::|
  Fly   273 PILIVSVAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLIS-----------IAIIF 326

  Fly   254 AALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAYYQIS 318
            ....||.....:..:.   |...|:..|.:.:.|...:...:|..|||:||:.|:|||:.:.:: 
  Fly   327 GVSWLPLNFFNLYADM---ERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQEL- 387

  Fly   319 WVRRWRDATQMKKFSRSPDHCCYCA---FMKNGKRTSEAAQKAGNLEKDISKDMSSAQ 373
                                .|.|:   ...||..|....|.|....:.:..::|..:
  Fly   388 --------------------LCRCSDTNVALNGHTTGCNVQAAARRRRKLGAELSKGE 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 73/299 (24%)
7tm_1 48..303 CDD:278431 65/283 (23%)
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 27/96 (28%)
7tm_1 103..373 CDD:278431 65/283 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.