DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and npy8br

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_571511.1 Gene:npy8br / 30713 ZFINID:ZDB-GENE-980526-208 Length:375 Species:Danio rerio


Alignment Length:350 Identity:79/350 - (22%)
Similarity:147/350 - (42%) Gaps:22/350 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQN 96
            |:.|..:..::|.||.||..:|.||...:.:|:.||:.|.|::.:|:|...:|..:.::......
Zfish    26 TFLIVAYSTMLAVGLVGNTCLVVVITRQKEMRNVTNIFIVNLSCSDILVCLVCLPVTIIYTLMDR 90

  Fly    97 YQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLA 161
            :.||...||:..|:..:.:..::.::.:::.:|...|:.|...:..:|...:.|...|:....::
Zfish    91 WILGEALCKVTPFVQCMSVTVSIFSMVLIALERHQLIIHPTGWKPVVRHSYLAVAVIWIIACFIS 155

  Fly   162 SPLAFYRSYRVRVWKNFT-------------ERYCKENTSVLPKYWYVLITILVWLPLGIMLICY 213
            .|...:.......:.|.:             |::..|...:  .|...|:.....|||.::|:||
Zfish   156 LPFLSFNILTNSPFHNLSLPFNPFSDHFICIEQWPSEGNRL--TYTTTLLLCQYCLPLALILVCY 218

  Fly   214 IAIFYKLDRYEKRVLSRENPLTVSYKRS--VAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVS 276
            ..||.:|.|.:..|...........|.|  |...|..:|..||...||..:...:.: :..|.:.
Zfish   219 FRIFLRLSRRKDMVERARGGRQKKAKGSKRVNAMLASIVAAFALCWLPLNVFNTIFD-WNHEAIP 282

  Fly   277 VSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAYYQ-ISWVRRWRDATQMKKF--SRSPDH 338
            |.....:| .........:..|||:||||.|.||::.... :|..|.|..|...:.|  |.....
Zfish   283 VCQHDAIF-SACHLTAMASTCVNPVIYGFLNNNFQKELKSLLSRCRCWGPAESYESFPLSTVSTG 346

  Fly   339 CCYCAFMKNGKRTSEAAQKAGNLEK 363
            ....:.:.||..::....|..:||:
Zfish   347 ITKGSILSNGSASTYQPHKKNSLEQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 65/285 (23%)
7tm_1 48..303 CDD:278431 56/269 (21%)
npy8brNP_571511.1 7tm_4 38..>162 CDD:304433 27/123 (22%)
7tm_1 42..308 CDD:278431 56/269 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.