DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and Npy4r

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_113769.1 Gene:Npy4r / 29471 RGDID:61864 Length:375 Species:Rattus norvegicus


Alignment Length:298 Identity:73/298 - (24%)
Similarity:126/298 - (42%) Gaps:31/298 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQL 99
            |.|:......|:.||..:::|....:...:.|||:|||:|.:|.|...||..:.:.......:..
  Rat    45 ITTYSVETVLGVLGNLCLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYWIF 109

  Fly   100 GCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASP- 163
            |.|.||:..|:..:.:..::|:|.:|:.:|...|:.|...:.:|....:.:|..|.....|:.| 
  Rat   110 GEVLCKMLTFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVVIWFISCFLSLPF 174

  Fly   164 --------LAFYRSYRV------RV-----WKNFTERYCKENTSVLPKYWYVLITILVWLPLGIM 209
                    |..|...:|      :|     |.:...|..         |...|:.....:||..:
  Rat   175 LANSILNDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLI---------YTTFLLLFQYCVPLAFI 230

  Fly   210 LICYIAIFYKLDRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGED 274
            |:||:.|:.:|.|..:...:......|...:.:...|..:|..||.|.||..:...| |.::.|.
  Rat   231 LVCYMRIYQRLQRQRRAFHTHTCSSRVGQMKRINGMLMAMVTAFAVLWLPLHVFNTL-EDWYQEA 294

  Fly   275 VSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRR 312
            :....|..:|.....:.| .:..|||.||||.|.||::
  Rat   295 IPACHGNLIFLMCHLFAM-ASTCVNPFIYGFLNINFKK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 71/289 (25%)
7tm_1 48..303 CDD:278431 63/274 (23%)
Npy4rNP_113769.1 7tm_4 52..>221 CDD:304433 39/177 (22%)
7tm_1 58..322 CDD:278431 63/274 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.