DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and Npy5r

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_037001.1 Gene:Npy5r / 25340 RGDID:3199 Length:445 Species:Rattus norvegicus


Alignment Length:389 Identity:70/389 - (17%)
Similarity:134/389 - (34%) Gaps:119/389 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGC 101
            ||:.|:  |..||..::..:...|:.::..|.:|.|:|.:|:|.:..|....:.:.....:..|.
  Rat    49 TFVSLL--GFMGNLLILMAVMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGK 111

  Fly   102 VGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAF 166
            ..|.:..||..|.::.:.|.|..::..|...|..|:...||......::...|..|..:.|||..
  Rat   112 AMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPV 176

  Fly   167 YRSYRVRVWKNF-----TERY-CKE---NTSVLPKYWYVLITILVWLPLGIMLICYIAI------ 216
            :.|. |.:.:.|     :.:| |.|   :.|....:...|:.:...|||..:.:.:.::      
  Rat   177 FHSL-VELKETFGSALLSSKYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC 240

  Fly   217 -------------------------------------FYKLDRYEKRVLSR-------------- 230
                                                 .|...|..:|..|:              
  Rat   241 GLSHKENRLEENEMINLTLQPSKKSRNQAKTPSTQKWSYSFIRKHRRRYSKKTACVLPAPAGPSQ 305

  Fly   231 -------ENPLTV-------------------------------SYKRSVAK----------TLF 247
                   |||.:|                               ..|||:.:          .|.
  Rat   306 GKHLAVPENPASVRSQLSPSSKVIPGVPICFEVKPEESSDAHEMRVKRSITRIKKRSRSVFYRLT 370

  Fly   248 IVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFR 311
            |:::|||...:|..:..|:.:  |.:::..:...:|.:.|...|..::..:||::|||.|...:
  Rat   371 ILILVFAVSWMPLHVFHVVTD--FNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 67/382 (18%)
7tm_1 48..303 CDD:278431 62/368 (17%)
Npy5rNP_037001.1 7tm_4 52..>170 CDD:304433 26/119 (22%)
7tm_1 58..424 CDD:278431 62/368 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.