DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and Npffr1

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001170982.1 Gene:Npffr1 / 237362 MGIID:2685082 Length:432 Species:Mus musculus


Alignment Length:335 Identity:81/335 - (24%)
Similarity:150/335 - (44%) Gaps:48/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQL 99
            |..:..:....:.||..:.:::..||.:|:.||:.|.|:||:|||....|....:|::....:..
Mouse    47 IAAYALIFLLCMVGNTLVCFIVLKNRHMRTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPF 111

  Fly   100 GCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPL 164
            ....||:.|.:..:.:..:|..|..::.:|...||.|...:||:|...:.:...|...:|:..|.
Mouse   112 DNATCKMSGLVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKALLTIAVIWALALLIMCPS 176

  Fly   165 AF----------------YRSYRV-RVWKNFTERYCKENTSVLPKYWYVLITILVWLPLGIMLIC 212
            |.                .|||.: ..|:.:.|:..::      .|..||...:...||.::::.
Mouse   177 AVTLTVTREEHHFMLDARNRSYPLYSCWEAWPEKGMRK------VYTAVLFAHIYLAPLALIVVM 235

  Fly   213 YIAIFYKLDRYEKRVLSRENPLT----VSYKRSVAKTLFIVVVVFAALR-LPFTILVVLREKYFG 272
            |..|..||.:........|..:.    .|.:|:....:.::|.:|..|. ||..:|::|.:  :|
Mouse   236 YARIARKLCQAPGPARDAEEAVAEGGRASRRRARVVHMLVMVALFFTLSWLPLWVLLLLID--YG 298

  Fly   273 EDVSVSSGMQLF------WYISQYLMFLNAAVNPLIYGFNNENFRRAYY-----QISWVRRWRDA 326
            |    .|.:||.      :.::.:|.|.:::.||:|||:.||||||.:.     |:.|: .|  |
Mouse   299 E----LSELQLHLLSVYAFPLAHWLAFFHSSANPIIYGYFNENFRRGFQAAFRAQLCWL-PW--A 356

  Fly   327 TQMKKFSRSP 336
            ...:.:|..|
Mouse   357 AHKQAYSERP 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 74/298 (25%)
7tm_1 48..303 CDD:278431 65/282 (23%)
Npffr1NP_001170982.1 7tm_4 54..>173 CDD:304433 30/118 (25%)
7tm_1 60..331 CDD:278431 65/282 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.