DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and Npy4r

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_032945.3 Gene:Npy4r / 19065 MGIID:105374 Length:375 Species:Mus musculus


Alignment Length:307 Identity:79/307 - (25%)
Similarity:131/307 - (42%) Gaps:48/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQN 96
            |:.|.|.|     |:.||..:::|....:...:.|||:|||:|.:|.|...||..:.:.......
Mouse    47 TYSIETIL-----GVLGNLCLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDY 106

  Fly    97 YQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLA 161
            :..|.|.||:..|:..:.:..::|:|.:|:.:|...|:.|...:.:|....:.:|..|.....|:
Mouse   107 WIFGEVLCKMLTFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSIFQAYLGIVVIWFVSCFLS 171

  Fly   162 SP---------LAFYRSYRV------RV-----WKNFTERYCKENTSVLPKYWYVLITILVWLPL 206
            .|         |..|...:|      :|     |.:...|..         |...|:.....:||
Mouse   172 LPFLANSTLNDLFHYNHSKVVEFLEDKVVCFVSWSSDHHRLI---------YTTFLLLFQYCIPL 227

  Fly   207 GIMLICYIAIFYKLDRYEKRVL------SRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVV 265
            ..:|:|||.|:.:|.| :|.|.      ||...:     :.:...|..:|..||.|.||..:...
Mouse   228 AFILVCYIRIYQRLQR-QKHVFHAHACSSRAGQM-----KRINSMLMTMVTAFAVLWLPLHVFNT 286

  Fly   266 LREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRR 312
            | |.::.|.:....| .|.:.:...|...:..|||.||||.|.||::
Mouse   287 L-EDWYQEAIPACHG-NLIFLMCHLLAMASTCVNPFIYGFLNINFKK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 75/295 (25%)
7tm_1 48..303 CDD:278431 67/280 (24%)
Npy4rNP_032945.3 7tm_4 52..>174 CDD:304433 32/126 (25%)
7tm_1 58..322 CDD:278431 67/280 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.