DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and Npy6r

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_035065.1 Gene:Npy6r / 18169 MGIID:1098590 Length:371 Species:Mus musculus


Alignment Length:338 Identity:75/338 - (22%)
Similarity:147/338 - (43%) Gaps:62/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ICTFLPLIAF------GLYGNFSMVYVI-ATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVND 92
            :...|.|||:      |::||.|::.:| ...|..::.||::|||::::|:|...:|....::..
Mouse    33 LAILLLLIAYTVILIMGIFGNLSLIIIIFKKQREAQNVTNILIANLSLSDILVCVMCIPFTVIYT 97

  Fly    93 FYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSG 157
            ...::..|...|||..::..|.:..::.:|.:::.:|...||.|...:..:......::..|:..
Mouse    98 LMDHWVFGNTMCKLTSYVQSVSVSVSIFSLVLIAIERYQLIVNPRGWKPRVAHAYWGIILIWLIS 162

  Fly   158 ILLASPLAFYRSYR----------------------VRVWKNFTERYCKENTSVLPKYWYVLITI 200
            :.|:.||  :.||.                      |.:|.:...:.....:..:.:|       
Mouse   163 LTLSIPL--FLSYHLTNEPFHNLSLPTDIYTHQVACVEIWPSKLNQLLFSTSLFMLQY------- 218

  Fly   201 LVWLPLGIMLICYIAIFYKLDRYEKRVLSR-ENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILV 264
              ::|||.:||||:.|...|.:..::|..| ||...::..:.|...|..:||.|.|..||..|..
Mouse   219 --FVPLGFILICYLKIVLCLRKRTRQVDRRKENKSRLNENKRVNVMLISIVVTFGACWLPLNIFN 281

  Fly   265 VLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAYYQISWVRRWRDATQM 329
            |:.:.|  .::.:|....|.:.:...:..::..:|||.|||.|:||::....:.           
Mouse   282 VIFDWY--HEMLMSCHHDLVFVVCHLIAMVSTCINPLFYGFLNKNFQKDLMMLI----------- 333

  Fly   330 KKFSRSPDHCCYC 342
                    |.|:|
Mouse   334 --------HHCWC 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 68/300 (23%)
7tm_1 48..303 CDD:278431 61/278 (22%)
Npy6rNP_035065.1 7tm_4 46..>95 CDD:304433 14/48 (29%)
7tm_1 52..318 CDD:278431 61/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.