DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and Npy2r

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_032757.2 Gene:Npy2r / 18167 MGIID:108418 Length:381 Species:Mus musculus


Alignment Length:310 Identity:94/310 - (30%)
Similarity:147/310 - (47%) Gaps:57/310 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQL 99
            |..:..:|..|:.||..:::|:...:|:|:.||..|||:||||||...:|....:.......:::
Mouse    54 ILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKM 118

  Fly   100 GCVGCKL----EGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILL 160
            |.|.|.|    :|..|.|..||    |:|::.||...||..:|::::.|...:::...|....||
Mouse   119 GPVLCHLVPYAQGLAVQVSTIT----LTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALL 179

  Fly   161 ASPLAFYRSYR-VRVWKNF-----TERYCKENTSVLPKYWYVLITILVW--LPLGIMLICYIAIF 217
            |||||.:|.|. :.:..:|     ||::..|..||.... |.|.|:|:.  |||||:...|..|:
Mouse   180 ASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTV-YSLSTLLILYVLPLGIISFSYTRIW 243

  Fly   218 YKL----------DRYEKRVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLP---FTILV----- 264
            .||          |.|.:|            :..:.|.|..||||||...||   |.:.|     
Mouse   244 SKLRNHVSPGAASDHYHQR------------RHKMTKMLVCVVVVFAVSWLPLHAFQLAVDIDSH 296

  Fly   265 VLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAY 314
            ||..|.:          :|.:.:...:...:...|||:||:.|.|:|:|:
Mouse   297 VLDLKEY----------KLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 92/301 (31%)
7tm_1 48..303 CDD:278431 85/284 (30%)
Npy2rNP_032757.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
7tmA_NPY2R 51..336 CDD:320521 93/308 (30%)
TM helix 1 52..78 CDD:320521 6/23 (26%)
TM helix 2 85..110 CDD:320521 12/24 (50%)
TM helix 3 123..153 CDD:320521 11/33 (33%)
TM helix 4 164..185 CDD:320521 7/20 (35%)
TM helix 5 216..245 CDD:320521 11/29 (38%)
TM helix 6 261..291 CDD:320521 12/41 (29%)
TM helix 7 304..329 CDD:320521 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.