DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30340 and NPFFR2

DIOPT Version :9

Sequence 1:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001138228.1 Gene:NPFFR2 / 10886 HGNCID:4525 Length:423 Species:Homo sapiens


Alignment Length:354 Identity:93/354 - (26%)
Similarity:165/354 - (46%) Gaps:62/354 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KWDFPAERIW-------------------------LHKPNGEITWKICTFLPLIAFGLYGNFSMV 53
            |||..:...|                         ||:|.....:.|..|| :....:.||..:.
Human     7 KWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFL-IFFLCMMGNTVVC 70

  Fly    54 YVIATNRSLRSPTNLIIANMAVADLLTLAICPAMFMVNDFYQNYQLGCVGCKLEGFLVVVFLITA 118
            :::..|:.:.:.|||.|.|:|::|||....|..:.::::....:..|...||:.|.:..:.:..:
Human    71 FIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAAS 135

  Fly   119 VLNLSVVSYDRLTAIVLPMETRLTIRGVQIVVVCTWVSGILLASPLAFY------RSYRVRV-WK 176
            |..|..::.||...:|.|.:.:|||:...::::..||..|.:.||.|..      :.||||: .:
Human   136 VFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQ 200

  Fly   177 NFTE--RYCKE---NTSVLPKYWYVLITILVWLPLGIMLICY----IAIFY-------KLDRYEK 225
            |.|.  .:|:|   |..:...|..||...:...||.:::|.|    |::|.       :.::.:.
Human   201 NKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQW 265

  Fly   226 RVLSRENPLTVSYKRSVAKTLFIVVVVFAALRLPFTILVVLREKYFGEDVSVSSGMQLFWYI--- 287
            .|:||:       |:.:.|.|.||.::|....||...|::|.:.   .|:|.:....:..||   
Human   266 HVVSRK-------KQKIIKMLLIVALLFILSWLPLWTLMMLSDY---ADLSPNELQIINIYIYPF 320

  Fly   288 SQYLMFLNAAVNPLIYGFNNENFRRAYYQ 316
            :.:|.|.|::|||:||||.||||||.:.:
Human   321 AHWLAFGNSSVNPIIYGFFNENFRRGFQE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 83/296 (28%)
7tm_1 48..303 CDD:278431 73/280 (26%)
NPFFR2NP_001138228.1 7tm_4 56..>178 CDD:304433 31/122 (25%)
7tm_1 65..336 CDD:278431 73/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1308959at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.