DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and YKL091C

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_012832.1 Gene:YKL091C / 853771 SGDID:S000001574 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:53/254 - (20%)
Similarity:94/254 - (37%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QPHLRARQDDQFLVGFLRGCKFSL---------------------------------EKTKSKLD 71
            :.:.:.|.||..|:.|||..||.:                                 :|.:.||.
Yeast    42 EKNYKERLDDSTLLRFLRARKFDINASVEMFVETERWREEYGANTIIEDYENNKEAEDKERIKLA 106

  Fly    72 HFYTIKTLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEFKLLDLFR 136
            ..|      |:.:.....|.|.|.....|. :.|.|.:.....:..|.|.    .||::|...:|
Yeast   107 KMY------PQYYHHVDKDGRPLYFEELGG-INLKKMYKITTEKQMLRNL----VKEYELFATYR 160

  Fly   137 YQTMITEQSIREDDHSNISGYV-----EIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRLKG 196
            ....           |..:||:     .::|:..:|||....: .:.||.:...::...|.|:..
Yeast   161 VPAC-----------SRRAGYLIETSCTVLDLKGISLSNAYHV-LSYIKDVADISQNYYPERMGK 213

  Fly   197 VHLINCPKEGVALLNLAKSLM-PSKLQQRFHV---YKNLEQLNEVIPREYLPEEYGGNN 251
            .::|:.|.....:..:.|..: |..:.:.|.:   ||  ::|.:.||.|.||.:|||.:
Yeast   214 FYIIHSPFGFSTMFKMVKPFLDPVTVSKIFILGSSYK--KELLKQIPIENLPVKYGGTS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 10/62 (16%)
CRAL_TRIO 109..250 CDD:279044 32/149 (21%)
YKL091CNP_012832.1 CRAL_TRIO_N 30..75 CDD:215024 9/32 (28%)
SEC14 101..271 CDD:214706 43/195 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.