DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and AT1G30690

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001031119.1 Gene:AT1G30690 / 839949 AraportID:AT1G30690 Length:540 Species:Arabidopsis thaliana


Alignment Length:262 Identity:58/262 - (22%)
Similarity:107/262 - (40%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AET-ELNEVEERVPADLKALRDW-LAKQPHLRARQDDQFLVGFLRGCKFS-------LEKT---- 66
            ||| |:.:.:|.|..|::.   | :...|...|...|..|:.|||...|.       |:||    
plant   187 AETIEVEDEDESVDKDIEL---WGVPLLPSKGAESTDVILLKFLRARDFKVNEAFEMLKKTLKWR 248

  Fly    67 -KSKLDHFYTIKTLMPELFGKRL--------VDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYE 122
             ::|:|      :::.|.||:.|        ||..:..:|.:.....|.:..|::      .|.|
plant   249 KQNKID------SILGEEFGEDLATAAYMNGVDRESHPVCYNVHSEELYQTIGSE------KNRE 301

  Fly   123 KFDPKEFKLLDLFRYQTMITEQSIREDD--HSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIF 185
            ||          .|::..:.|:.|::.:  ...::..::|.|:.........:: :..||::...
plant   302 KF----------LRWRFQLMEKGIQKLNLKPGGVTSLLQIHDLKNAPGVSRTEI-WVGIKKVIET 355

  Fly   186 AEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHV---YKNLEQLNEVIPREYLPEEY 247
            .:...|..:.....||.|....|:..:....:..:.:.:|.|   .|..|.|.:.||.:.||.:|
plant   356 LQDNYPEFVSRNIFINVPFWFYAMRAVLSPFLTQRTKSKFVVARPAKVRETLLKYIPADELPVQY 420

  Fly   248 GG 249
            ||
plant   421 GG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 13/54 (24%)
CRAL_TRIO 109..250 CDD:279044 29/146 (20%)
AT1G30690NP_001031119.1 CRAL_TRIO_N <219..244 CDD:215024 7/24 (29%)
SEC14 273..422 CDD:214706 31/165 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.