DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and Clvs1

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001342112.1 Gene:Clvs1 / 74438 MGIID:1921688 Length:354 Species:Mus musculus


Alignment Length:320 Identity:75/320 - (23%)
Similarity:137/320 - (42%) Gaps:37/320 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANLRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLR-ARQDDQFLVGFLRGCKFSLEK 65
            |.|.|.:.|..|:   ||||..:.:..|::.:||.:..:|.:. .|.||.|::.|||..||....
Mouse    28 AGLSPDTIEKARL---ELNENPDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQAD 89

  Fly    66 TKSKLDHFYTIKTLMPELF----------GKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTN 120
            ....|..::..:.|..::|          .:.|:|....:|.....|          |.::.|..
Mouse    90 AFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHY----------GRKILLLF 144

  Fly   121 YEKFDPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIF 185
            ...:|.......|:.| ..:::.:.:.||....|:|::.|:|.:..|....::|..:::|.....
Mouse   145 AANWDQSRNSFTDILR-AILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEG 208

  Fly   186 AEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVY-KNLEQLNEVIPREYLPEEYGG 249
            .:.:.|.|..|||.:|.|....||..|.|..:..|.::|..:: .||..|:::|..|:||.|:||
Mouse   209 LQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGG 273

  Fly   250 -----NNGRIA------DIQAEAEKKLLSYESYFAEDSQYGVDEQLRPGKRVNADSIFGA 298
                 :.|..|      |...|.:....||.:...:.:...::.:..|.....:.|:..|
Mouse   274 TLPPYDMGTWARTLLGPDYSDENDYTHTSYNAMHVKHTCSNLERECSPKPMKRSQSVVEA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 13/42 (31%)
CRAL_TRIO 109..250 CDD:279044 37/146 (25%)
Clvs1NP_001342112.1 CRAL_TRIO_N 51..97 CDD:215024 14/45 (31%)
CRAL_TRIO 125..274 CDD:366224 38/159 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..354 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.