DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and Sec14l1

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:255 Identity:47/255 - (18%)
Similarity:91/255 - (35%) Gaps:65/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLDHFYTIKTLMPELFGKRLVDERNLILC 97
            ||.|| ::.|......|:.::.|||...|:::|.:.                          |:|
Mouse   262 LRQWL-QETHKGKIPKDEHILRFLRARDFNIDKARE--------------------------IMC 299

  Fly    98 RSGTYVR------LPKPW-----------------GTDGPRLQLTNYEKFDPKEF-KLLD---LF 135
            :|.|:.:      :...|                 ..||..|.:....:.|.|.. :.|.   |.
Mouse   300 QSLTWRKQHQVDYILDTWTPPQVLLDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEALL 364

  Fly   136 RYQTMITEQSIREDDHSN------ISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRL 194
            ||...|.|:.:|..:.:.      ||.:..:||:..:::..|.:.....:.|:....|...|..|
Mouse   365 RYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETL 429

  Fly   195 KGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQ-----LNEVIPREYLPEEYGG 249
            ..:.::..|:....|..|....:....:::|.:|...:.     |.:.|.:|.:|:...|
Mouse   430 GRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSG 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 11/36 (31%)
CRAL_TRIO 109..250 CDD:279044 32/173 (18%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 47/255 (18%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 13/65 (20%)
CRAL_TRIO 326..490 CDD:279044 31/164 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.