DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and Sec14l2

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_653103.1 Gene:Sec14l2 / 67815 MGIID:1915065 Length:403 Species:Mus musculus


Alignment Length:294 Identity:67/294 - (22%)
Similarity:113/294 - (38%) Gaps:62/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKL----------DHFYTIK 77
            ||.:....:.::|.|...|:    .||.||:.:||...|.|:|:::.|          |....|.
Mouse    13 EEALAKFRENVQDVLPTLPN----PDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDKIIS 73

  Fly    78 TLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEFKLL-------DLF 135
            ...||:..:.|...|    |          .:..||..:.   |:...|.:.|.|       ||.
Mouse    74 WQPPEVIQQYLSGGR----C----------GYDLDGCPVW---YDIIGPLDAKGLLFSASKQDLL 121

  Fly   136 RYQ----TMITEQSIREDDH--SNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFA---EKAQP 191
            |.:    .::.::.|::...  ..|.....|.|...:.|..|.:   ..::..|.|.   |:..|
Mouse   122 RTKMRDCELLLQECIQQTTKLGKKIETITMIYDCEGLGLKHLWK---PAVEAYGEFLTMFEENYP 183

  Fly   192 TRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHV----YKNLEQLNEVIPREYLPEEYGGNNG 252
            ..||.:.::..||......||.|..:....:::..|    :|  |.|.:.|..:.||.||||.  
Mouse   184 ETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWK--EVLLKHISPDQLPVEYGGT-- 244

  Fly   253 RIADIQAEAEKKLLSYESYFAE-DSQYGVDEQLR 285
             :.|  .:...|..|..:|..: ..||.|.:|::
Mouse   245 -MTD--PDGNPKCKSKINYGGDIPKQYYVRDQVK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 12/41 (29%)
CRAL_TRIO 109..250 CDD:279044 36/160 (23%)
Sec14l2NP_653103.1 CRAL_TRIO_N 13..59 CDD:215024 15/49 (31%)
SEC14 76..244 CDD:214706 41/189 (22%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.