DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and clvs2

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001020716.1 Gene:clvs2 / 566769 ZFINID:ZDB-GENE-041014-313 Length:329 Species:Danio rerio


Alignment Length:256 Identity:61/256 - (23%)
Similarity:117/256 - (45%) Gaps:25/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLR-ARQDDQFLVGFLRGCKFS-------- 62
            ||.|....|:.||.|..:.:..|::.:||.:..:|.:. .|.||.|::.|||..||:        
Zfish     8 LSPETLEKAKVELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLL 72

  Fly    63 ---LEKTKSKLDHFYTIKTLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKF 124
               .|..:..||.|..:|...|.: .:.|.|....:|.....|          |.::.:.....:
Zfish    73 AQYFEYRQQNLDMFKNLKATDPGI-KQALKDGFPGVLSNLDRY----------GRKILVLFAANW 126

  Fly   125 DPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKA 189
            |...:..:|:.| ..:::.:::.||....::|:|.|:|.:..:....::|..::::......:.:
Zfish   127 DQSRYTFVDILR-AILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDS 190

  Fly   190 QPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVY-KNLEQLNEVIPREYLPEEYGG 249
            .|.|..|:|.:|.|....||..:.:..:..|.::|..:: .||..|:::|..|.||.|.||
Zfish   191 FPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLILPEILPSELGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 14/53 (26%)
CRAL_TRIO 109..250 CDD:279044 31/142 (22%)
clvs2NP_001020716.1 CRAL_TRIO_N 29..75 CDD:215024 13/45 (29%)
SEC14 106..251 CDD:238099 31/155 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579378
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.