DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and ttpal

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001016176.1 Gene:ttpal / 548930 XenbaseID:XB-GENE-976635 Length:338 Species:Xenopus tropicalis


Alignment Length:290 Identity:84/290 - (28%)
Similarity:141/290 - (48%) Gaps:23/290 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSAELRRIAETELNEVEERVPADLKALRDWLAKQ-PHLRARQDDQFLVGFLRGCKFSLEKTKSKL 70
            ||.||...|..||.|..|....|::||||.:.|. |||:.|.||.||:.|||..||..::....|
 Frog    32 LSPELVLKAREELQEKPEWRLRDVQALRDMVWKDYPHLKTRVDDSFLLRFLRARKFDYDRALQLL 96

  Fly    71 DHFYTIKTLMPELFG-------KRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKE 128
            .::|:.:...||:|.       |.::|        ||....||.. .|:|.|:.......:.|::
 Frog    97 VNYYSCRKAWPEVFTDLRPSAVKPVLD--------SGFLTVLPHT-DTEGRRIVCIRPGCWIPRD 152

  Fly   129 FKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTR 193
            :.:.:..|...:..|:.: |.:.:.::|.|.:.|...:.|:..:.....:.|::....:...|.|
 Frog   153 YPITENIRAIYLSLEKLV-ESEETQVNGIVILADYNGVGLTHASHFGPFIAKKVIGILQDGFPIR 216

  Fly   194 LKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVY-KNLEQLNEVIPREYLPEEYGGNNGRIADI 257
            :|.|::||.|:....:..:.|..:..|:.:||.:: .:|..|:..||:..|||||||..|:: |.
 Frog   217 IKAVNVINEPRIFKGIFAILKPFLKEKIVKRFFLHGSDLNSLHANIPKSILPEEYGGTAGKL-DT 280

  Fly   258 QAEAEKKLLSYESYFAEDSQYGVDEQLRPG 287
            .|.:: .||..|..||  ..:|:....|.|
 Frog   281 TAWSQ-ILLDSEEDFA--VHFGLAHPTREG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 19/42 (45%)
CRAL_TRIO 109..250 CDD:279044 33/141 (23%)
ttpalNP_001016176.1 CRAL_TRIO_N 53..99 CDD:215024 20/45 (44%)
SEC14 119..274 CDD:238099 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.