DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and Sec14l4

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:309 Identity:73/309 - (23%)
Similarity:121/309 - (39%) Gaps:60/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANLRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEK 65
            :.:|.|...|    |.|...|:          |:|.|...|    :.||.||:.:||...|.|:|
  Rat     5 VGDLSPQQQE----ALTRFREI----------LQDVLPTLP----KADDFFLLRWLRARNFDLKK 51

  Fly    66 T------------KSKLDHFYTIKTLMPELFGKRLVDERNLILCRSGTYVRLPKPW----GTDGP 114
            :            :..|||..|.:.  ||:.  ||.|...  || ...|...| .|    ||..|
  Rat    52 SEDMLRKHVEFRNQQDLDHILTWQP--PEVI--RLYDSGG--LC-GYDYEGCP-VWFDLIGTLDP 108

  Fly   115 RLQLTNYEKFD--PKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFT 177
            :....:..|.|  .|..|:.::..::..:..|.:..    .:...|.:.||..:||..|.:....
  Rat   109 KGLFMSASKQDLIRKRIKVCEMLLHECELQSQKLGR----KVERMVMVFDMEGLSLRHLWKPAVE 169

  Fly   178 LIKRMGIFAEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHV----YKNLEQLNEVI 238
            :.::.....|...|..:|.:.:|..||......||.||.:....|::..:    :|  ::|.:.:
  Rat   170 VYQQFFAILEANYPETVKNLIVIRAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWK--QELLKFM 232

  Fly   239 PREYLPEEYGGNNGRIADIQAEAEKKLLSYESYFAE-DSQYGVDEQLRP 286
            ..:.||.|:||.   :.|  .:...|.|:..:|..: ...|.:..|.||
  Rat   233 SPDQLPVEFGGT---MTD--PDGNPKCLTKINYGGDVPKHYHLSSQERP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 13/53 (25%)
CRAL_TRIO 109..250 CDD:279044 32/150 (21%)
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 17/63 (27%)
SEC14 76..244 CDD:214706 41/181 (23%)
GOLD_2 284..379 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.