DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and CG11550

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:291 Identity:91/291 - (31%)
Similarity:146/291 - (50%) Gaps:12/291 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLDHFYTIKTLMPELFGKR 87
            |.|.|..||.| ||:..|||:..|..:...:.|...|::|:|..|..||...|.:|.:.|.| ..
  Fly    15 EIRRPEVLKFL-DWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHLEEFF-VN 77

  Fly    88 LVDERNLILCRSGTYVRLPKPWGT-DGPRLQLTNYEKFDPKEFKLLDLFRYQTMITEQSIREDDH 151
            |..||..|.....|...:|.|..| :|.|:.|...:..:...:...|:.:...|:.:..:.||..
  Fly    78 LDCERPEIRRAMRTVSIVPLPGATPEGYRVILAKLDDLNTSNYNFADVMKLYCMVFDFWMYEDGI 142

  Fly   152 SNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRLKGVHLINCPKEGVALLNLAKSL 216
            .  .|:|.::|:...||..:|::....:|:...:.::|...||.|.|.||.......:|.|....
  Fly   143 Q--PGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFMDKILALMTPF 205

  Fly   217 MPSKLQQRFHVYKNLEQLNEVIPREYLPEEYGGNNGRIADIQAEAE---KKLLSYESYFAE-DSQ 277
            |..:|....|::.:|::..:.:|:|.||:|||   |::.:.....|   ||||.......| :::
  Fly   206 MKKELTTVLHMHSDLKEFYKFVPQEMLPKEYG---GQLEEANVAKEIYYKKLLDNRKEMIEFETR 267

  Fly   278 YGVDEQLRPGKRVNADSIFGAEGSFRKLDID 308
            :.|:|:|||||..||..:||.||:|:|||||
  Fly   268 HQVNEKLRPGKAKNASDLFGIEGNFKKLDID 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 14/41 (34%)
CRAL_TRIO 109..250 CDD:279044 35/141 (25%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 37/149 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.