DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and rlbp1a

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_956999.1 Gene:rlbp1a / 393678 ZFINID:ZDB-GENE-040426-1662 Length:312 Species:Danio rerio


Alignment Length:271 Identity:69/271 - (25%)
Similarity:120/271 - (44%) Gaps:25/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AETELNEVEERVPADLKALR----------DWLAKQPHLR-ARQDDQFLVGFLRGCKFSLEKTKS 68
            |:.||||.:|:..:.:|.||          |.:||....: .::.|..|:.|:|..||.:.:...
Zfish    47 AKDELNETDEKRASAIKELRAMIKDKAGQGDEVAKTVQDKFGKEPDSLLLRFIRARKFDVARAHE 111

  Fly    69 KLDHFYTIKTLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEFKLLD 133
            .:..:...:...|||| :.|..|.......:| |.|:......:|..:.|.|.:.:|.:|....:
Zfish   112 LMKGYVRFRRDYPELF-ENLTPEAVRSTIEAG-YPRILSTRDKNGRVVLLFNIDNWDLEEVTFDE 174

  Fly   134 LFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRLKGVH 198
            ..|...:|.|: :.|::.:.|:|:|.|.:....::...:.:..|.:|:|....:.:.|.|.|.||
Zfish   175 TLRAYCVILEK-LLENEETQINGFVLIENFKGFTMQHASGIKHTELKKMVDMLQDSFPARFKAVH 238

  Fly   199 LINCPKEGVALLNLAKSLMPSKLQQRFHVY-KNLEQLNEVIPREYLPEEYGGN----NGRIADIQ 258
            :|:.|.......|:.|..|.|||.:|..|: ..|:........|.||.::.|.    :||     
Zfish   239 VIHQPWYFTTTYNVVKPFMKSKLLERVFVHGDELDGYLRDFGAEILPPDFDGTGPACDGR----- 298

  Fly   259 AEAEKKLLSYE 269
             |...||...|
Zfish   299 -ETAIKLFGSE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 12/52 (23%)
CRAL_TRIO 109..250 CDD:279044 35/141 (25%)
rlbp1aNP_956999.1 CRAL_TRIO_N 59..116 CDD:215024 12/56 (21%)
CRAL_TRIO 142..291 CDD:279044 38/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.