DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and CG33966

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001033984.1 Gene:CG33966 / 3885642 FlyBaseID:FBgn0053966 Length:310 Species:Drosophila melanogaster


Alignment Length:310 Identity:132/310 - (42%)
Similarity:201/310 - (64%) Gaps:2/310 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANLRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEK 65
            |..:||||.||::.|...||||..::..|:.|||||:.:||||:||.||||||.||||||||||:
  Fly     1 MPAIRPLSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLER 65

  Fly    66 TKSKLDHFYTIKTLMPELFGKRLVD-ERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEF 129
            ||||:|.|||::|..||.:....|| ::.|.:.|.||.|.||:|...:||||.|.....:||.::
  Fly    66 TKSKIDRFYTLRTKYPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKY 130

  Fly   130 KLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRL 194
            .|.::.|...::.:..:.|||.:.::|.:.|:|::.::.....|:..:..|:|.:|.|:|.|.|.
  Fly   131 TLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRP 195

  Fly   195 KGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVY-KNLEQLNEVIPREYLPEEYGGNNGRIADIQ 258
            :|:|.||.|.....:.|:.|.:|..|.|.|.:|: ...|.|...||::|||.||||.||.|.::.
  Fly   196 QGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIPKQYLPVEYGGENGSIPELL 260

  Fly   259 AEAEKKLLSYESYFAEDSQYGVDEQLRPGKRVNADSIFGAEGSFRKLDID 308
            .:.|:::|:|.:|:.|:..||.||.||.|:.|:.:|:||.:||||:|::|
  Fly   261 QQWEQRILAYRNYWEEEKNYGTDESLRVGQPVDFESLFGLQGSFRQLNVD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 31/41 (76%)
CRAL_TRIO 109..250 CDD:279044 45/141 (32%)
CG33966NP_001033984.1 CRAL_TRIO_N 30..72 CDD:215024 31/41 (76%)
SEC14 96..252 CDD:238099 52/155 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.850

Return to query results.
Submit another query.