DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and CG32485

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster


Alignment Length:210 Identity:46/210 - (21%)
Similarity:78/210 - (37%) Gaps:48/210 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SAELRRIAETELNEVEER----VPADLKALRDWLAKQPHLRA--RQDDQFLVGFLRGCKFS---- 62
            |.||..|.|.:..:::||    |.||.|...:..:.:.:|||  ..||.| ...|:..|:.    
  Fly     3 SEELAPINEQDFKDLKERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAF-QAILKTNKWRETYG 66

  Fly    63 ----LEKTKSKLDHFYTIKTLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEK 123
                .|..:|:||.            ..||:..|:   |.....:.:|               .|
  Fly    67 VDKLSEMDRSQLDK------------KARLLRHRD---CIGRPVIYIP---------------AK 101

  Fly   124 FDPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEK 188
            ....|..:.:|.|:.....|::.::...........:.|:|:.|.|.   :|:.|::.:.....|
  Fly   102 NHSSERDIDELTRFIVYNLEEACKKCFEEVTDRLCIVFDLAEFSTSC---MDYQLVQNLIWLLGK 163

  Fly   189 AQPTRLKGVHLINCP 203
            ..|.||....:||.|
  Fly   164 HFPERLGVCLIINSP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 13/51 (25%)
CRAL_TRIO 109..250 CDD:279044 18/95 (19%)
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 21/115 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.