DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and CG13893

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:342 Identity:75/342 - (21%)
Similarity:128/342 - (37%) Gaps:80/342 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLE----------KTKS----- 68
            |.|:.|...|.|:..|..:  ...|....||.|||.:||..|::||          ||::     
  Fly     5 LPEISEEQRAILEKFRKQM--DDALVGTHDDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVD 67

  Fly    69 ---KLDHFYTIKTLMPELFGKRLVDERN--LILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKE 128
               |.|....::..:|  :|....|...  :::|....:    ..||      .:....:|:.::
  Fly    68 NIEKWDPPKALQEYLP--YGLMGYDNEGSPVLVCPFANF----DMWG------MMHCVTRFEFQK 120

  Fly   129 FKLLDLFRYQTMITEQSIREDDHSNISGY-----VEIVDMAKMSLSF-----LAQLDFTLIKRMG 183
            :.:|.|.|:..:..:||.:.       |:     |...||..::|..     .|:...:.:|:. 
  Fly   121 YLVLLLERFMKIAYDQSQKH-------GWRARQLVVFFDMQDVNLKQYAWRPAAECVISTVKQY- 177

  Fly   184 IFAEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKN-----LEQLNEVIPREYL 243
               |...|..||..::||.||......|:.|..:......:..:||:     .|||...:.|:..
  Fly   178 ---EANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAF 239

  Fly   244 PEEYGGNNGRIADIQAEAEKKLLSY-------ESYFAEDSQYG----VDEQLRPGK------RVN 291
            |:.:|   |.:.|...:.:.|.|..       |.|..:.||..    |:.|:..|.      :||
  Fly   240 PKAWG---GEMVDRNGDPQCKALMVWGGKLPEELYIDQSSQQSDRDFVEAQVPKGDKLKLHFKVN 301

  Fly   292 ADSIFGAEGSFRKLDID 308
            .:........||..|.|
  Fly   302 VEEQKILSWEFRTFDYD 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 16/59 (27%)
CRAL_TRIO 109..250 CDD:279044 33/155 (21%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 13/42 (31%)
SEC14 75..246 CDD:238099 37/196 (19%)
GOLD_2 303..381 CDD:290608 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.