DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and Sec14l3

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:311 Identity:73/311 - (23%)
Similarity:112/311 - (36%) Gaps:70/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANLRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEK 65
            :.:|.|..||       .|.:..|.|...|.||           ...||.||:.:||...|.|:|
Mouse     5 VGDLSPKQAE-------TLAKFRENVQDVLPAL-----------PNPDDYFLLRWLRARNFDLQK 51

  Fly    66 TKSKLDHFYTIKTLM----------PELFGKRLVDERNLILC---RSGTYVRLPKPWGTDGPRLQ 117
            :::.|..:...:..|          ||:..|.:...    ||   |.|    .|..:...||   
Mouse    52 SEAMLRKYMEFRKTMDIDHILDWQPPEVIQKYMPGG----LCGYDRDG----CPVWYDIIGP--- 105

  Fly   118 LTNYEKFDPKE--FKLL--DLFRYQTMITEQSIREDD------HSNISGYVEIVDMAKMSLS-FL 171
                  .|||.  |.:.  ||.:.:....|:.:.|.|      ...|...|.|.|...:.|. |.
Mouse   106 ------LDPKGLLFSVTKQDLLKTKMRDCERILHECDLQTERLGRKIETIVMIFDCEGLGLKHFW 164

  Fly   172 AQLDFTLIKRMGIFAEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKN---LEQ 233
            ..|.....:..|:. |:..|..||.:.::...|......||.|..:....:::..|..:   .|.
Mouse   165 KPLVEVYQEFFGLL-EENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEG 228

  Fly   234 LNEVIPREYLPEEYGGNNGRIADIQAEAEKKLLSYESYFAE--DSQYGVDE 282
            |.::|..|.||..:||.   :.|  .:...|.|:..:|..|  .|.|..|:
Mouse   229 LLKLISPEELPAHFGGT---LTD--PDGNPKCLTKINYGGEIPKSMYVRDQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 12/41 (29%)
CRAL_TRIO 109..250 CDD:279044 35/154 (23%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 18/63 (29%)
SEC14 76..246 CDD:214706 44/190 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.