DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and Sec14l1

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:290 Identity:52/290 - (17%)
Similarity:102/290 - (35%) Gaps:81/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IAETELNEVEERVPAD----------------LKALRDWLAKQPHLRARQDDQFLVGFLRGCKFS 62
            :||..:...::::.||                |..||.|| ::.|......|:.::.|||...|:
  Rat   228 VAEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWL-QETHKGKIPKDEHILRFLRARDFN 291

  Fly    63 LEKTKSKLDHFYTIKTLMPELFGKRLVDERNLILCRSGTYVR------LPKPW------------ 109
            ::|.:.                          |:|:|.|:.:      :...|            
  Rat   292 IDKARE--------------------------IMCQSLTWRKQHQVDYILDTWTPPQVLQDYYAG 330

  Fly   110 -----GTDGPRLQLTNYEKFDPKEF-KLLD---LFRYQTMITEQSIREDDHSN------ISGYVE 159
                 ..||..|.:....:.|.|.. :.|.   |.||...|.|:.:|..:.:.      ||.:..
  Rat   331 GWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTC 395

  Fly   160 IVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQR 224
            :||:..:::..|.:.....:.|:....|...|..|..:.::..|:....|..|....:....:::
  Rat   396 LVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRK 460

  Fly   225 FHVYKNLEQ-----LNEVIPREYLPEEYGG 249
            |.:|...:.     |.:.|.:|.:|:...|
  Rat   461 FLIYAGNDYQGPGGLLDYIDKEIIPDFLSG 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 14/57 (25%)
CRAL_TRIO 109..250 CDD:279044 32/173 (18%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 14/71 (20%)
CRAL_TRIO 327..491 CDD:279044 31/164 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.