DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and CG10026

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:259 Identity:56/259 - (21%)
Similarity:116/259 - (44%) Gaps:33/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ETELNEVEERVPADLKAL------------------RDWLAK----QPHLRARQDDQFLVGFLRG 58
            |.:||..||.||..::.|                  |:::.:    |||   |.|.::|..|||.
  Fly    14 EHKLNITEEEVPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPH---RSDAKYLEKFLRA 75

  Fly    59 CKFSLEKTKSKLDHFYTIKTLMPELFGK-RLVDERNLILCRSGTYVRLPKPW-GTDGPRLQLTNY 121
            ..:.:|.:...|..:|..:......:.| |.:|.|::    ..:.:....|: ...|.|:.:..:
  Fly    76 RYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHV----GQSDILTVTPYRDQHGHRILIYRF 136

  Fly   122 EKFDPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFA 186
            ..:.|.:..:.|:|| .|::.::....:..|.|.|.|.|.|:..:.|..:..|..::.::|....
  Fly   137 GLWRPNQVTVDDIFR-ATIVLQELGSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALL 200

  Fly   187 EKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVY-KNLEQLNEVIPREYLPEEYGG 249
            ..:.|.|...:|::|......|...:.|..:.:.::::.::: .::..|::.|..|:||:.|||
  Fly   201 VTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPKRYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 12/63 (19%)
CRAL_TRIO 109..250 CDD:279044 30/143 (21%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 12/49 (24%)
SEC14 112..265 CDD:238099 31/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.