DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and CG10237

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:291 Identity:71/291 - (24%)
Similarity:126/291 - (43%) Gaps:38/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SAELRRIAETELNEVEERVPADLKALRDWL-AKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLD 71
            :|:.:.:|..||.|..||.....|.|...| |:...|..:.::::|:.:||.||:..|..:..:.
  Fly    49 TAQGKEVAIKELRETPERQKEASKELARLLEAETDLLYPKGNEEWLIRYLRPCKYYPESARDLIK 113

  Fly    72 HFYTIKTLMPELF------GKRLVDERNLI--------LCRSGTYVRLPKPWGTDGPRLQLTNYE 122
            .:|..|....:::      .:..:.:.|::        |.|....:.|.|.|             
  Fly   114 RYYAFKVKHADVYTDLKPSNEANIFKHNILTVFPNRDQLGRRILVLELGKRW------------- 165

  Fly   123 KFDPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAE 187
              ..|:..|.::|:...:..|.::.|.: :.|.|.|.|.||..:||....|......||:..:.:
  Fly   166 --KHKQVTLDEVFKGAVLFLEAAMLEPE-TQICGAVVIFDMDGLSLQQTWQFTPPFAKRIVDWLQ 227

  Fly   188 KAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQR--FHVYKNLEQLNEVIPREYLPEEYGG- 249
            .:.|.|:|.:|::|.||....:..|.|..:..||:.|  || ..:.|.|::.:..:.||..||| 
  Fly   228 DSVPLRIKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFH-GTDRESLHKYMSPKCLPAAYGGF 291

  Fly   250 -NNGRIADIQAEAEKKLLSYESYFAEDSQYG 279
             ...||...|  ..:.||..::.|...:.||
  Fly   292 REASRIDSDQ--WYQLLLKCDTEFDTINSYG 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 11/42 (26%)
CRAL_TRIO 109..250 CDD:279044 38/144 (26%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 11/46 (24%)
SEC14 137..290 CDD:238099 41/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447130
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105497
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.750

Return to query results.
Submit another query.