DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and Ku80

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:329 Identity:67/329 - (20%)
Similarity:109/329 - (33%) Gaps:142/329 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AETELNEVEERVPA-DLK-ALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLDHFYTIK 77
            :|.:||.:::.:.: ||: .|||  .:||...|:.|   |:.|                      
  Fly   420 SEEQLNAIDQLIDSTDLECTLRD--TQQPRPWAQND---LLPF---------------------- 457

  Fly    78 TLMPELFGKRLVD--ERNLILCR------------SGTYVRLPKPWGTDGPRLQLTNYEKFDPKE 128
            ..:|.:|.:.::|  ||.:|...            :..:.|:|.|         |....|.....
  Fly   458 DALPSIFEQNVMDILERKVIYDNDKEDKMLKDKNFADVFWRVPDP---------LEEKSKRAAAI 513

  Fly   129 FKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTR 193
            .|.|...||.....|:.:.::...|                             |: |.|::|..
  Fly   514 VKKLFPLRYSRAWQEKLLAKEQAEN-----------------------------GV-AVKSEPAE 548

  Fly   194 LKGVHLINCPKEGVALLN---------------------------LA---KSLMPSKLQQRFHVY 228
            .:    |..|.:||.|::                           ||   :.::.:.||:|   .
  Fly   549 KE----IPLPSDGVGLIDPISDFRRVLASVHTISNATERDARFQALAADTRVVIITLLQRR---K 606

  Fly   229 KNLEQLNEVIP---------REYLPEEYGGNNGRIADIQAEAEKK--LLSYESYFAEDSQYGVDE 282
            :|:.||.|:|.         ..:|  ||        |..||..||  |....|.|.:|..  ||:
  Fly   607 QNIGQLGELITLYRQSCIDFNTFL--EY--------DKFAEELKKIALAKNRSEFWQDVM--VDK 659

  Fly   283 QLRP 286
            ||.|
  Fly   660 QLGP 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 11/43 (26%)
CRAL_TRIO 109..250 CDD:279044 30/179 (17%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 29/139 (21%)
Ku_PK_bind 562..663 CDD:285938 26/115 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.