DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and CG5973

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:303 Identity:81/303 - (26%)
Similarity:132/303 - (43%) Gaps:46/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SAELR-----------RIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKF 61
            ||::|           :.|:.||.||.......:|.||:.:..:.:|....||::::.|||...:
  Fly    21 SAQIRMEKEQAPEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHY 85

  Fly    62 SLEKTKSKLDHFYTIK--------TLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPR-LQ 117
            ..|....:|.:||.:|        .::|...  |.|.|.|::..       ||:. ...|.| |.
  Fly    86 YPESALKRLKNFYHMKLKYGAACENIIPSKL--RNVFEANILNL-------LPQR-DQHGRRLLV 140

  Fly   118 LTNYEKFDPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRM 182
            |...:|:.|.:..|:|||| ...:|......:.:|.|.|.|.|:||..:.||.:.|...:....:
  Fly   141 LEAGKKWKPSQVPLVDLFR-GIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAML 204

  Fly   183 GIFAEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQR--FHVYKNLEQLNEVIPREYLPE 245
            ..:.::....|||.||::|.......|..:.|..:..||::|  || .|:.:.|...|..:.||.
  Fly   205 LDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFH-GKDYKSLISHIEAKALPP 268

  Fly   246 EYGGN------NGRIADIQAEAEKKLLSYESYFAEDSQYGVDE 282
            :|||:      :|::.....|...|     .|...|| ||..|
  Fly   269 KYGGSATWELPHGKVLGEFFECYSK-----DYELADS-YGYTE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 10/41 (24%)
CRAL_TRIO 109..250 CDD:279044 42/143 (29%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 11/44 (25%)
SEC14 116..272 CDD:238099 47/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.