DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and Ttpal

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:284 Identity:79/284 - (27%)
Similarity:133/284 - (46%) Gaps:33/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSAELRRIAETELNEVEERVPADLKALRDWLAKQ-PHLRARQDDQFLVGFLRGCKFSLEKTKSKL 70
            |:.:|...|..||.|..|....|::||||.:.|: |:|....||.||:.|||..||..::....|
  Rat    36 LTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLL 100

  Fly    71 DHFYTIKTLMPELFG----KRLVDERNLILCRSGTYVRLPKPWGTD--GPRLQLTNYEKFDPKEF 129
            .:::..:...||:|.    ..|.|..|     ||....||.   ||  |..:.....:::.|..:
  Rat   101 VNYHGCRRSWPEVFSNLRPSALKDVLN-----SGFLTVLPH---TDPRGCHVLCIRPDRWIPSNY 157

  Fly   130 KLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLS-------FLAQLDFTLIKRMGIFAE 187
            .:.:..| ...:|.:.:.:.:.:.::|.|.:.|...:|||       |:|:      |.:||. :
  Rat   158 PITENIR-AIYLTLEKLIQSEETQVNGVVILADYKGVSLSKASHFGPFIAR------KVIGIL-Q 214

  Fly   188 KAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVY-KNLEQLNEVIPREYLPEEYGGNN 251
            ...|.|:|.||::|.|:....:..:.|..:..|:..||.:: .:|..|:..:||..||:||||..
  Rat   215 DGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLSSLHTSLPRNILPKEYGGTA 279

  Fly   252 GRIADIQAEAEKKLLSYESYFAED 275
            |.:.  .|.....||:.|..|.::
  Rat   280 GELD--TASWNAVLLASEDDFVKE 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 17/42 (40%)
CRAL_TRIO 109..250 CDD:279044 37/150 (25%)
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 18/45 (40%)
SEC14 122..278 CDD:238099 44/171 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105497
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.