DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and Sec14l5

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:294 Identity:53/294 - (18%)
Similarity:107/294 - (36%) Gaps:71/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLEKTKSKLDHFYTIKTLMPELFGKRLVDERNL 94
            |..||.|| ::.|......|:.::.|||...|.|:|.:.                          
  Rat   246 LVQLRRWL-QETHKGKIPKDEHILRFLRARDFHLDKARD-------------------------- 283

  Fly    95 ILCRSGTYVR------LPKPWGTDGPRLQL----TNYEKFDPKEFKLLDLFRYQT-----MITEQ 144
            :||:|.::.:      |.:.|....|..:.    .:|:..|.:...:|.|.:..|     .:.|:
  Rat   284 MLCQSLSWRKQHQVDLLLQTWRPPAPLQEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEE 348

  Fly   145 -------SIREDDHSN-----------ISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQP 191
                   |:.|:....           ||.:..::|:..:::..|.:.....:.||....|...|
  Rat   349 ALLQHVLSVNEEGQKRCEGNTRQFGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYP 413

  Fly   192 TRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQ-----LNEVIPREYLPEEYGGNN 251
            ..|..:.::..|:....|..|....:....:::|.:|.....     |.:.:.::.:|:..||.:
  Rat   414 ETLGRLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYSGSNYQGPGGLVDYLDKDVIPDFLGGES 478

  Fly   252 GRIADIQAEAEKKLLSYESYFAEDSQYGVDEQLR 285
              :.::   .|..::....|..|:.|...| |||
  Rat   479 --VCNV---PEGGMVPKSLYLTEEEQEQAD-QLR 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 13/39 (33%)
CRAL_TRIO 109..250 CDD:279044 27/172 (16%)
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489 18/89 (20%)
CRAL_TRIO_N 243..288 CDD:215024 15/68 (22%)
CRAL_TRIO 314..477 CDD:306996 25/162 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.