DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and R03A10.5

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:279 Identity:50/279 - (17%)
Similarity:93/279 - (33%) Gaps:82/279 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKFSLE-KTKSKLDHF 73
            :::::.|...:::.|....|...|| ||.....|...:       ..|..||.|. :....||  
 Worm    15 KIQQLRELVKDDISEYYNTDFNILR-WLQGHNTLPIEE-------IARKMKFHLNLRAAWNLD-- 69

  Fly    74 YTIKTLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNY-------EKFD----PK 127
                    ||..|    |||..:.:...|       |..||...:.|.       .|.|    .:
 Worm    70 --------ELHKK----ERNHPIHKHWKY-------GITGPSGHMDNVIVNIEQCGKTDYTGMME 115

  Fly   128 EFKLLDLFRYQTMITEQSIRE-----------------DDHSNISGYVEIVDMAKMSLSFLAQLD 175
            .:.:|::.|.:.:..||.:..                 .|.:.:....::.|:...|:..||  |
 Worm   116 TYSILEVMRARMVDLEQMLHHVMELEAKTGKQAWILYVMDITGLQYNKKLYDLVTGSMKSLA--D 178

  Fly   176 FT---LIKRMGIFAEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQLNEV 237
            |.   .::.:..|..            :..|....||..:.:.|:|.|.:::..:.......::|
 Worm   179 FMADHYVEMIKYFVP------------VCVPSFATALYVVVRPLLPEKTREKVRLIGETNWRDDV 231

  Fly   238 IPREY-----LPEEYGGNN 251
            :  :|     ||..:...|
 Worm   232 L--QYAIHSSLPSIWNNEN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 10/42 (24%)
CRAL_TRIO 109..250 CDD:279044 28/176 (16%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 31/195 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.