DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30339 and cgr-1

DIOPT Version :9

Sequence 1:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:275 Identity:56/275 - (20%)
Similarity:105/275 - (38%) Gaps:71/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LNEV----EERVPADLKA-LRDWLAKQPHLRARQDDQF-LVGFLRGCKFSLEKTKSKLDHFYTIK 77
            |||:    :::: |:|:: .:|.||..|    ..|..| |:.:|.|..:.::....|:.  |.::
 Worm    10 LNELTAHQKDKI-AELRSKTKDILATYP----EYDTDFSLLRWLMGWDYKIDVIVPKMR--YAVE 67

  Fly    78 TLMPELFGKRLV--------DERNL----------ILCRS--GTYVRL-------PKPWGTDGPR 115
            ||:......:..        |.:|:          |:.:|  |..|.:       ||.....||.
 Worm    68 TLVNLGMNNKQTTSVDQINRDIKNMSAVAEYFPGGIMGKSKRGDVVYMQAMAKAHPKTLVKAGPT 132

  Fly   116 LQLTNYEKFDPKEFKLLDLFRYQTMI--TEQSIR-----EDDHSNISGYVEIVDMAKMSLSFLAQ 173
            .||                  :|..|  ||.|.:     |.:.....|.:.|:|:...|:..|..
 Worm   133 SQL------------------FQLCISETEMSFKIIRQTEQETERKMGVIIIMDLDGFSMDLLYT 179

  Fly   174 LDFTLIKRMGIFAEKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHV----YKNLEQL 234
            ....:...:....:...|...:.:::||||....|:..:...::.|:.:::...    :||  .|
 Worm   180 PTLKVYMSLLTMLQNIFPDFARRIYIINCPAMMSAVYAMVSPVLSSQTREKVRFLDKDWKN--HL 242

  Fly   235 NEVIPREYLPEEYGG 249
            .|.|..|.:...:||
 Worm   243 IEEIGEENIFMHWGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 11/43 (26%)
CRAL_TRIO 109..250 CDD:279044 30/152 (20%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 35/185 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.